Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179U439

Protein Details
Accession A0A179U439   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
11-40LRIIKAREHCHRLKREKKKTFKNNTDNTACHydrophilic
NLS Segment(s)
PositionSequence
24-29KREKKK
Subcellular Location(s) mito 21, nucl 4
Family & Domain DBs
Amino Acid Sequences MLFLFKYSAVLRIIKAREHCHRLKREKKKTFKNNTDNTACERLKKKTKLTEKKGIEALFRSQMYFMIQNIEKIVLLSEHVNLLITEVEPEAADQEMQDFEIQIDLAEEEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.34
3 0.38
4 0.44
5 0.51
6 0.57
7 0.59
8 0.67
9 0.73
10 0.78
11 0.83
12 0.85
13 0.87
14 0.9
15 0.92
16 0.92
17 0.93
18 0.93
19 0.92
20 0.88
21 0.85
22 0.79
23 0.7
24 0.64
25 0.61
26 0.5
27 0.46
28 0.42
29 0.42
30 0.48
31 0.52
32 0.53
33 0.55
34 0.65
35 0.7
36 0.74
37 0.76
38 0.69
39 0.67
40 0.64
41 0.56
42 0.46
43 0.37
44 0.31
45 0.25
46 0.22
47 0.19
48 0.15
49 0.14
50 0.15
51 0.14
52 0.12
53 0.13
54 0.13
55 0.13
56 0.13
57 0.13
58 0.11
59 0.1
60 0.11
61 0.06
62 0.07
63 0.07
64 0.07
65 0.07
66 0.07
67 0.07
68 0.07
69 0.07
70 0.07
71 0.06
72 0.06
73 0.06
74 0.06
75 0.06
76 0.06
77 0.06
78 0.06
79 0.06
80 0.05
81 0.06
82 0.07
83 0.07
84 0.08
85 0.07
86 0.07
87 0.08
88 0.08
89 0.06
90 0.07