Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4N7T8

Protein Details
Accession G4N7T8   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
17-44GSSGPFGRERDKKKRDSRRVGSLKREAABasic
NLS Segment(s)
PositionSequence
22-40FGRERDKKKRDSRRVGSLK
Subcellular Location(s) nucl 12.5, mito 10, cyto_nucl 9, cyto 4.5
Family & Domain DBs
KEGG mgr:MGG_17187  -  
Amino Acid Sequences MWRNRSELGFVKQSRHGSSGPFGRERDKKKRDSRRVGSLKREAAESADIYLRKPLAEWVNRVGQRSSSPGVAAQLGSEQTGDHSFFVNKRCKGLKYKREKAGELSKSVNGLPAFPVCFEPSCSQMKVGMINTTKTGIIGERMGPSKANG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.45
3 0.4
4 0.34
5 0.38
6 0.41
7 0.4
8 0.4
9 0.38
10 0.43
11 0.5
12 0.56
13 0.6
14 0.62
15 0.66
16 0.73
17 0.83
18 0.86
19 0.88
20 0.87
21 0.87
22 0.89
23 0.86
24 0.84
25 0.81
26 0.74
27 0.64
28 0.57
29 0.46
30 0.38
31 0.32
32 0.24
33 0.17
34 0.16
35 0.15
36 0.14
37 0.16
38 0.14
39 0.12
40 0.11
41 0.14
42 0.18
43 0.21
44 0.23
45 0.25
46 0.32
47 0.33
48 0.35
49 0.31
50 0.25
51 0.23
52 0.24
53 0.22
54 0.15
55 0.14
56 0.13
57 0.13
58 0.12
59 0.1
60 0.07
61 0.06
62 0.06
63 0.06
64 0.05
65 0.04
66 0.05
67 0.06
68 0.07
69 0.06
70 0.07
71 0.08
72 0.11
73 0.17
74 0.24
75 0.24
76 0.27
77 0.3
78 0.33
79 0.43
80 0.51
81 0.55
82 0.59
83 0.67
84 0.71
85 0.73
86 0.71
87 0.68
88 0.67
89 0.61
90 0.54
91 0.47
92 0.39
93 0.36
94 0.34
95 0.31
96 0.21
97 0.18
98 0.16
99 0.15
100 0.15
101 0.14
102 0.16
103 0.13
104 0.14
105 0.17
106 0.18
107 0.2
108 0.23
109 0.23
110 0.22
111 0.23
112 0.24
113 0.24
114 0.24
115 0.27
116 0.25
117 0.26
118 0.26
119 0.26
120 0.24
121 0.2
122 0.19
123 0.13
124 0.14
125 0.15
126 0.16
127 0.19
128 0.21
129 0.22