Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G4MNH0

Protein Details
Accession G4MNH0    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
19-43DASSARIKKNKKSNQVKFKVRCQKNHydrophilic
NLS Segment(s)
PositionSequence
24-30RIKKNKK
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG mgr:MGG_06952  -  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPREVADIKKFIEICRRKDASSARIKKNKKSNQVKFKVRCQKNLYTLILKDAEKAEKLKQSLPPSLTVTEVSKSDKKSKSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.49
3 0.5
4 0.45
5 0.51
6 0.55
7 0.53
8 0.57
9 0.61
10 0.6
11 0.67
12 0.71
13 0.72
14 0.77
15 0.76
16 0.76
17 0.78
18 0.78
19 0.8
20 0.86
21 0.88
22 0.82
23 0.83
24 0.83
25 0.75
26 0.73
27 0.68
28 0.65
29 0.61
30 0.62
31 0.55
32 0.47
33 0.44
34 0.38
35 0.35
36 0.29
37 0.24
38 0.2
39 0.19
40 0.17
41 0.19
42 0.21
43 0.23
44 0.25
45 0.27
46 0.32
47 0.36
48 0.4
49 0.4
50 0.4
51 0.38
52 0.37
53 0.34
54 0.29
55 0.26
56 0.22
57 0.22
58 0.25
59 0.26
60 0.31
61 0.39