Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4MUN4

Protein Details
Accession G4MUN4    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MTWVYRKKLRCNKLLGKEHHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito 9, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004217  Tim10-like  
IPR035427  Tim10-like_dom_sf  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0015031  P:protein transport  
KEGG mgr:MGG_11338  -  
Pfam View protein in Pfam  
PF02953  zf-Tim10_DDP  
Amino Acid Sequences MTWVYRKKLRCNKLLGKEHHLSIDQRNASQLKPHKTTYATTMDASDVEKLQPKDKAELLQFVNNEQQRTKVQSQTHNLTEVCWKKCVTSIKGNGLEKSEEQCLASCVDRFLDVNLATMQHLSTLRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.8
3 0.77
4 0.72
5 0.66
6 0.59
7 0.51
8 0.43
9 0.39
10 0.41
11 0.34
12 0.31
13 0.34
14 0.32
15 0.3
16 0.35
17 0.38
18 0.37
19 0.4
20 0.41
21 0.4
22 0.41
23 0.42
24 0.39
25 0.37
26 0.31
27 0.27
28 0.26
29 0.22
30 0.21
31 0.2
32 0.15
33 0.1
34 0.09
35 0.14
36 0.14
37 0.16
38 0.2
39 0.2
40 0.22
41 0.23
42 0.26
43 0.22
44 0.26
45 0.25
46 0.24
47 0.23
48 0.21
49 0.25
50 0.23
51 0.23
52 0.18
53 0.19
54 0.17
55 0.24
56 0.25
57 0.26
58 0.29
59 0.35
60 0.41
61 0.44
62 0.43
63 0.4
64 0.37
65 0.32
66 0.36
67 0.35
68 0.31
69 0.28
70 0.27
71 0.25
72 0.3
73 0.37
74 0.34
75 0.37
76 0.42
77 0.48
78 0.55
79 0.57
80 0.52
81 0.47
82 0.44
83 0.36
84 0.33
85 0.26
86 0.2
87 0.18
88 0.18
89 0.16
90 0.16
91 0.16
92 0.14
93 0.13
94 0.13
95 0.13
96 0.13
97 0.14
98 0.17
99 0.15
100 0.17
101 0.17
102 0.17
103 0.16
104 0.16
105 0.14
106 0.12