Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4MR18

Protein Details
Accession G4MR18   
Localization Confidence Low
Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
40-59REKGPPGKTKNKEKKDFACTBasic
NLS Segment(s)
Subcellular Location(s) nucl 10mito 10mito_nucl 10
Family & Domain DBs
KEGG mgr:MGG_16115  -  
Amino Acid Sequences MSRTHSGEPPQIPRKDAQPKGEKIGAPQLCMGMLSDDWVREKGPPGKTKNKEKKDFACTGSRGGWILGLDEDH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.55
3 0.56
4 0.56
5 0.56
6 0.57
7 0.6
8 0.63
9 0.54
10 0.46
11 0.49
12 0.41
13 0.32
14 0.29
15 0.24
16 0.19
17 0.18
18 0.16
19 0.07
20 0.06
21 0.06
22 0.06
23 0.06
24 0.07
25 0.08
26 0.08
27 0.08
28 0.13
29 0.18
30 0.25
31 0.32
32 0.39
33 0.49
34 0.56
35 0.67
36 0.73
37 0.77
38 0.79
39 0.79
40 0.8
41 0.78
42 0.76
43 0.69
44 0.66
45 0.58
46 0.53
47 0.47
48 0.4
49 0.32
50 0.26
51 0.24
52 0.16
53 0.16