Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4MQT8

Protein Details
Accession G4MQT8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
9-28IRTHHITSRKKIQRLRKAATHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 26
Family & Domain DBs
KEGG mgr:MGG_15312  -  
Amino Acid Sequences MTRLFNALIRTHHITSRKKIQRLRKAATEHSVHYVLIRSGGAPGIMYAEAVEEASVREWVDAVQALRYKDFRCVFKPAPAAAEIAQAGFQEVGAVSEFAKEMERRGLGSWWRRGMGYE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.5
3 0.58
4 0.61
5 0.63
6 0.7
7 0.75
8 0.78
9 0.81
10 0.79
11 0.76
12 0.73
13 0.71
14 0.69
15 0.62
16 0.53
17 0.47
18 0.42
19 0.33
20 0.28
21 0.24
22 0.17
23 0.15
24 0.13
25 0.08
26 0.08
27 0.08
28 0.07
29 0.05
30 0.05
31 0.05
32 0.05
33 0.05
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.03
40 0.03
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.05
48 0.06
49 0.05
50 0.07
51 0.1
52 0.1
53 0.12
54 0.14
55 0.14
56 0.2
57 0.24
58 0.25
59 0.26
60 0.33
61 0.34
62 0.38
63 0.41
64 0.34
65 0.32
66 0.29
67 0.28
68 0.2
69 0.2
70 0.15
71 0.11
72 0.11
73 0.09
74 0.09
75 0.07
76 0.06
77 0.05
78 0.04
79 0.05
80 0.05
81 0.06
82 0.05
83 0.06
84 0.06
85 0.07
86 0.1
87 0.1
88 0.12
89 0.17
90 0.18
91 0.18
92 0.2
93 0.26
94 0.31
95 0.39
96 0.45
97 0.44
98 0.44