Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G4N353

Protein Details
Accession G4N353    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
163-183ETEEEKGKKKQEKVKEKIEEDAcidic
NLS Segment(s)
Subcellular Location(s) extr 11, E.R. 7, mito 5, golg 3, mito_nucl 3
Family & Domain DBs
KEGG mgr:MGG_04925  -  
Amino Acid Sequences MGSITMIRLLVAYLVLVLASVAMAMPTSLLATATARTTLCPDDRVLEPLPANRTLAEQMNIQATDDGILPECYKKCMKSEDGKANVTLSSLTVEAWCYNSVDFVNSQAWLNNYVLPCVKYECADNLSGKARRARAWWRDTCGSWDRKSTPEIDAGCGKAQEEETEEEKGKKKQEKVKEKIEEDEEEESGYGLGYGYGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.03
5 0.03
6 0.02
7 0.02
8 0.02
9 0.02
10 0.02
11 0.02
12 0.03
13 0.03
14 0.03
15 0.03
16 0.04
17 0.05
18 0.06
19 0.07
20 0.08
21 0.09
22 0.09
23 0.1
24 0.12
25 0.16
26 0.17
27 0.17
28 0.17
29 0.19
30 0.2
31 0.24
32 0.22
33 0.22
34 0.21
35 0.24
36 0.26
37 0.24
38 0.23
39 0.19
40 0.2
41 0.19
42 0.2
43 0.17
44 0.15
45 0.15
46 0.17
47 0.17
48 0.15
49 0.13
50 0.11
51 0.1
52 0.09
53 0.08
54 0.06
55 0.07
56 0.07
57 0.11
58 0.11
59 0.13
60 0.15
61 0.16
62 0.18
63 0.23
64 0.28
65 0.33
66 0.41
67 0.48
68 0.5
69 0.5
70 0.47
71 0.43
72 0.37
73 0.29
74 0.2
75 0.11
76 0.07
77 0.06
78 0.06
79 0.05
80 0.06
81 0.06
82 0.07
83 0.07
84 0.06
85 0.06
86 0.07
87 0.07
88 0.07
89 0.07
90 0.07
91 0.08
92 0.08
93 0.08
94 0.08
95 0.09
96 0.1
97 0.1
98 0.11
99 0.11
100 0.11
101 0.13
102 0.12
103 0.12
104 0.12
105 0.13
106 0.1
107 0.12
108 0.13
109 0.14
110 0.15
111 0.15
112 0.16
113 0.22
114 0.24
115 0.25
116 0.28
117 0.28
118 0.28
119 0.33
120 0.4
121 0.42
122 0.49
123 0.51
124 0.52
125 0.54
126 0.52
127 0.54
128 0.52
129 0.48
130 0.42
131 0.43
132 0.39
133 0.38
134 0.39
135 0.36
136 0.3
137 0.31
138 0.3
139 0.27
140 0.27
141 0.26
142 0.26
143 0.23
144 0.21
145 0.16
146 0.16
147 0.13
148 0.14
149 0.16
150 0.17
151 0.21
152 0.22
153 0.25
154 0.3
155 0.33
156 0.39
157 0.43
158 0.49
159 0.55
160 0.64
161 0.71
162 0.74
163 0.8
164 0.81
165 0.77
166 0.75
167 0.71
168 0.63
169 0.56
170 0.51
171 0.41
172 0.32
173 0.28
174 0.22
175 0.16
176 0.13
177 0.09
178 0.05