Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4MU49

Protein Details
Accession G4MU49   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
16-35ETPISPSRPNQRRKNSLEEHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR043451  Myocardin-like  
IPR004018  RPEL_repeat  
KEGG mgr:MGG_07237  -  
Pfam View protein in Pfam  
PF02755  RPEL  
PROSITE View protein in PROSITE  
PS51073  RPEL  
Amino Acid Sequences MAEDNKNIESQPAVDETPISPSRPNQRRKNSLEEHLKNRPERAELVDRNILPASTAAPALQEKQKELAKHMRADSLNEKIAHRPSPDELIKKGVLDEDPRTAEEKYAEAIEDEYAKREGGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.14
4 0.2
5 0.21
6 0.2
7 0.19
8 0.24
9 0.35
10 0.43
11 0.52
12 0.55
13 0.64
14 0.72
15 0.76
16 0.81
17 0.76
18 0.76
19 0.78
20 0.74
21 0.71
22 0.7
23 0.7
24 0.62
25 0.58
26 0.51
27 0.42
28 0.37
29 0.36
30 0.37
31 0.32
32 0.35
33 0.37
34 0.35
35 0.34
36 0.32
37 0.25
38 0.16
39 0.15
40 0.11
41 0.07
42 0.07
43 0.05
44 0.06
45 0.07
46 0.09
47 0.11
48 0.1
49 0.1
50 0.15
51 0.17
52 0.17
53 0.21
54 0.28
55 0.3
56 0.33
57 0.34
58 0.35
59 0.33
60 0.37
61 0.36
62 0.31
63 0.31
64 0.28
65 0.28
66 0.27
67 0.3
68 0.29
69 0.26
70 0.24
71 0.23
72 0.29
73 0.33
74 0.33
75 0.31
76 0.32
77 0.32
78 0.29
79 0.28
80 0.22
81 0.2
82 0.2
83 0.22
84 0.22
85 0.23
86 0.24
87 0.25
88 0.24
89 0.23
90 0.2
91 0.19
92 0.16
93 0.15
94 0.14
95 0.13
96 0.13
97 0.12
98 0.15
99 0.15
100 0.15
101 0.16