Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4MU35

Protein Details
Accession G4MU35   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
92-120AITKRCEHCKVVRRKRGKRHRGYLYIICSHydrophilic
NLS Segment(s)
PositionSequence
104-112RRKRGKRHR
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG mgr:MGG_07225  -  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
Amino Acid Sequences MSGMAILGKAPRVGTSLLLSRCARATPAVGHKACLVQPQQTRSLWHRTPTTTTACNGSSRINSLLSARPRVGAVQTALRQLQQARGMKLRSAITKRCEHCKVVRRKRGKRHRGYLYIICSANPRHKQRQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.16
3 0.21
4 0.22
5 0.27
6 0.27
7 0.26
8 0.26
9 0.25
10 0.23
11 0.17
12 0.19
13 0.19
14 0.27
15 0.34
16 0.33
17 0.34
18 0.33
19 0.34
20 0.32
21 0.32
22 0.25
23 0.24
24 0.28
25 0.31
26 0.34
27 0.33
28 0.36
29 0.35
30 0.42
31 0.37
32 0.38
33 0.38
34 0.35
35 0.39
36 0.38
37 0.39
38 0.31
39 0.29
40 0.28
41 0.26
42 0.24
43 0.21
44 0.19
45 0.15
46 0.15
47 0.16
48 0.13
49 0.12
50 0.13
51 0.17
52 0.18
53 0.19
54 0.17
55 0.17
56 0.16
57 0.16
58 0.15
59 0.12
60 0.11
61 0.13
62 0.14
63 0.16
64 0.16
65 0.16
66 0.17
67 0.15
68 0.18
69 0.21
70 0.23
71 0.24
72 0.28
73 0.29
74 0.29
75 0.32
76 0.31
77 0.31
78 0.34
79 0.37
80 0.38
81 0.46
82 0.48
83 0.53
84 0.54
85 0.52
86 0.55
87 0.59
88 0.65
89 0.67
90 0.74
91 0.77
92 0.83
93 0.89
94 0.91
95 0.92
96 0.92
97 0.91
98 0.91
99 0.88
100 0.85
101 0.82
102 0.76
103 0.71
104 0.6
105 0.51
106 0.45
107 0.42
108 0.44
109 0.46
110 0.49