Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4N8Y6

Protein Details
Accession G4N8Y6   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
204-228EPPLAQYMKKIPKKPKGGKGPGVIPHydrophilic
NLS Segment(s)
PositionSequence
212-223KKIPKKPKGGKG
Subcellular Location(s) mito 10, cyto 7.5, extr 6, cyto_nucl 6, nucl 3.5
Family & Domain DBs
KEGG mgr:MGG_03353  -  
Amino Acid Sequences MVSMIKQSGGASLVLLLLALFATLASATPVPAPQQPQFDQQQSLGPTQELEVAAEPKPPIQAPSPGNGDATVDQDTGQVTITKPPGDNGTVSIPIRAMIYHGVPGPKDCRGGPMGVVEIPGPGKALAGQGERCYDLAETANCGVFMSNKADGCEARLFSDLGCRNEDFVNIVVFMPEYRSIGGVWKSMGIRCGVPEPDPATLGEPPLAQYMKKIPKKPKGGKGPGVIPVQPTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.05
4 0.04
5 0.04
6 0.03
7 0.03
8 0.02
9 0.03
10 0.03
11 0.03
12 0.05
13 0.05
14 0.06
15 0.07
16 0.08
17 0.1
18 0.14
19 0.19
20 0.21
21 0.28
22 0.3
23 0.35
24 0.4
25 0.41
26 0.4
27 0.36
28 0.37
29 0.33
30 0.33
31 0.27
32 0.22
33 0.19
34 0.17
35 0.19
36 0.14
37 0.12
38 0.12
39 0.13
40 0.13
41 0.15
42 0.15
43 0.13
44 0.14
45 0.14
46 0.14
47 0.15
48 0.22
49 0.21
50 0.26
51 0.29
52 0.28
53 0.28
54 0.25
55 0.24
56 0.18
57 0.18
58 0.15
59 0.11
60 0.11
61 0.11
62 0.11
63 0.09
64 0.09
65 0.08
66 0.07
67 0.11
68 0.12
69 0.13
70 0.13
71 0.14
72 0.16
73 0.16
74 0.16
75 0.14
76 0.15
77 0.17
78 0.16
79 0.16
80 0.13
81 0.12
82 0.12
83 0.1
84 0.08
85 0.06
86 0.07
87 0.08
88 0.09
89 0.09
90 0.09
91 0.11
92 0.12
93 0.13
94 0.14
95 0.12
96 0.14
97 0.14
98 0.15
99 0.14
100 0.12
101 0.12
102 0.1
103 0.1
104 0.08
105 0.07
106 0.06
107 0.06
108 0.05
109 0.04
110 0.04
111 0.04
112 0.05
113 0.07
114 0.08
115 0.09
116 0.1
117 0.11
118 0.12
119 0.11
120 0.11
121 0.09
122 0.08
123 0.1
124 0.09
125 0.09
126 0.1
127 0.1
128 0.09
129 0.09
130 0.08
131 0.07
132 0.08
133 0.1
134 0.12
135 0.12
136 0.13
137 0.14
138 0.14
139 0.17
140 0.18
141 0.15
142 0.14
143 0.15
144 0.15
145 0.13
146 0.22
147 0.23
148 0.22
149 0.24
150 0.22
151 0.23
152 0.23
153 0.24
154 0.17
155 0.14
156 0.13
157 0.11
158 0.1
159 0.09
160 0.08
161 0.08
162 0.09
163 0.08
164 0.08
165 0.08
166 0.09
167 0.09
168 0.14
169 0.15
170 0.14
171 0.14
172 0.16
173 0.17
174 0.18
175 0.19
176 0.16
177 0.15
178 0.16
179 0.2
180 0.18
181 0.18
182 0.22
183 0.23
184 0.22
185 0.23
186 0.21
187 0.2
188 0.19
189 0.19
190 0.16
191 0.13
192 0.14
193 0.17
194 0.18
195 0.15
196 0.17
197 0.26
198 0.35
199 0.43
200 0.5
201 0.56
202 0.65
203 0.76
204 0.83
205 0.84
206 0.85
207 0.87
208 0.87
209 0.83
210 0.79
211 0.75
212 0.7
213 0.61