Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4N308

Protein Details
Accession G4N308   
Localization Confidence Low
Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
76-97VSSCRAGHKRQKPSALWKRAKQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 9.5, cyto_nucl 8.833, cyto_mito 6.666, cyto 2.5
Family & Domain DBs
KEGG mgr:MGG_07648  -  
Amino Acid Sequences MPHTILTKSPSLLCLPSVYTSGHSNITNTQDDQEDLFGDSPEEIDPEILQEILGKDREQEAEDEGPAPAPQGHNPVSSCRAGHKRQKPSALWKRAKQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.17
4 0.18
5 0.16
6 0.16
7 0.17
8 0.18
9 0.19
10 0.18
11 0.17
12 0.19
13 0.23
14 0.23
15 0.21
16 0.21
17 0.18
18 0.19
19 0.18
20 0.15
21 0.11
22 0.1
23 0.1
24 0.08
25 0.07
26 0.07
27 0.07
28 0.06
29 0.06
30 0.05
31 0.05
32 0.04
33 0.05
34 0.05
35 0.04
36 0.04
37 0.04
38 0.05
39 0.06
40 0.07
41 0.07
42 0.07
43 0.09
44 0.1
45 0.1
46 0.1
47 0.12
48 0.12
49 0.13
50 0.13
51 0.11
52 0.11
53 0.1
54 0.1
55 0.08
56 0.08
57 0.09
58 0.14
59 0.16
60 0.18
61 0.19
62 0.23
63 0.26
64 0.26
65 0.25
66 0.28
67 0.35
68 0.41
69 0.5
70 0.56
71 0.63
72 0.69
73 0.77
74 0.76
75 0.79
76 0.81
77 0.82
78 0.82