Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G4MZY4

Protein Details
Accession G4MZY4    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
45-67YSVYRSARTKRRAVKPRPASSTLHydrophilic
NLS Segment(s)
PositionSequence
55-56RR
Subcellular Location(s) mito 19, nucl 5, cyto 1, extr 1, pero 1, cyto_pero 1
Family & Domain DBs
KEGG mgr:MGG_16767  -  
Amino Acid Sequences SVAGQVRCPGRQVAYPGKPLEAHMVPPCLGSICITAQPSPYISSYSVYRSARTKRRAVKPRPASSTLDQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.43
3 0.42
4 0.41
5 0.39
6 0.36
7 0.35
8 0.26
9 0.24
10 0.21
11 0.22
12 0.2
13 0.2
14 0.19
15 0.13
16 0.12
17 0.1
18 0.09
19 0.07
20 0.09
21 0.1
22 0.1
23 0.1
24 0.1
25 0.11
26 0.11
27 0.11
28 0.11
29 0.11
30 0.12
31 0.13
32 0.16
33 0.22
34 0.21
35 0.23
36 0.28
37 0.36
38 0.44
39 0.49
40 0.55
41 0.58
42 0.68
43 0.77
44 0.8
45 0.82
46 0.83
47 0.86
48 0.85
49 0.8