Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4N7T3

Protein Details
Accession G4N7T3   
Localization Confidence Low
Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MPSLGFLKKKRTRDGNNDNSSQPHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 12.5, nucl 12, cyto 9, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000961  AGC-kinase_C  
IPR011009  Kinase-like_dom_sf  
IPR000719  Prot_kinase_dom  
IPR017441  Protein_kinase_ATP_BS  
IPR008271  Ser/Thr_kinase_AS  
Gene Ontology GO:0005952  C:cAMP-dependent protein kinase complex  
GO:0005829  C:cytosol  
GO:0000324  C:fungal-type vacuole  
GO:0005634  C:nucleus  
GO:0005524  F:ATP binding  
GO:0004691  F:cAMP-dependent protein kinase activity  
GO:0010619  P:adenylate cyclase-activating glucose-activated G protein-coupled receptor signaling pathway  
GO:0045721  P:negative regulation of gluconeogenesis  
GO:0010515  P:negative regulation of induction of conjugation with cellular fusion  
GO:0000122  P:negative regulation of transcription by RNA polymerase II  
GO:0051094  P:positive regulation of developmental process  
GO:0046827  P:positive regulation of protein export from nucleus  
GO:0006468  P:protein phosphorylation  
KEGG mgr:MGG_06368  -  
Pfam View protein in Pfam  
PF00069  Pkinase  
PROSITE View protein in PROSITE  
PS51285  AGC_KINASE_CTER  
PS00107  PROTEIN_KINASE_ATP  
PS50011  PROTEIN_KINASE_DOM  
PS00108  PROTEIN_KINASE_ST  
CDD cd05580  STKc_PKA_like  
Amino Acid Sequences MPSLGFLKKKRTRDGNNDNSSQPASPVTPTAAQSFEQAQVLGAPSAINNSHAHTQQQSYLVPQPGYSVGTEVQAQQPQMNSISQQQQQAFAPPAHTPSPGTIDPQQSLPSISNLMNPAVQQQNSQPSANFQPQSQSQSQSQSQFPLPPSHGNGDQSQQQNFQVQQQIQSQQDAMDIQPSQVQDQSHSQQAQPQHQPQHHVQHHVNHAHQGSQDQQTRVTKGKYSLTDFEILRTLGTGSFGRVHLVQSRHNQRFYAVKVLKKAQVVKMKQVEHTNDERKMLGEVKNPFLITLWGTFQDCRNLYMVMDFVEGGELFSLLRKSGRFPNPVAKFYAAEVTLALEYLHAKNIIYRDLKPENLLLDRHGHLKITDFGFAKRVPDKTWTLCGTPDYLAPEVVSNKGYNKSVDWWSLGILIYEMLCGYTPFWDSGSPMKIYENILKGKVRYPAYINPDAQDLLQRLITADLTKRLGNLYGGSQDVRNHPWFAEVTWDRLARKDIDAPYTPPVKAGAGDASQFDRYPEETERYGQTGHDEYGNLFPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.86
3 0.86
4 0.82
5 0.73
6 0.66
7 0.58
8 0.47
9 0.37
10 0.29
11 0.23
12 0.2
13 0.21
14 0.21
15 0.22
16 0.23
17 0.25
18 0.24
19 0.22
20 0.24
21 0.25
22 0.23
23 0.2
24 0.18
25 0.16
26 0.15
27 0.16
28 0.13
29 0.11
30 0.09
31 0.08
32 0.11
33 0.11
34 0.12
35 0.12
36 0.15
37 0.2
38 0.21
39 0.24
40 0.25
41 0.27
42 0.28
43 0.31
44 0.28
45 0.28
46 0.33
47 0.35
48 0.31
49 0.29
50 0.27
51 0.25
52 0.25
53 0.21
54 0.17
55 0.13
56 0.14
57 0.15
58 0.15
59 0.18
60 0.19
61 0.2
62 0.2
63 0.2
64 0.21
65 0.22
66 0.2
67 0.17
68 0.21
69 0.27
70 0.29
71 0.34
72 0.33
73 0.34
74 0.34
75 0.36
76 0.34
77 0.27
78 0.26
79 0.21
80 0.24
81 0.23
82 0.23
83 0.2
84 0.19
85 0.24
86 0.22
87 0.25
88 0.27
89 0.29
90 0.29
91 0.3
92 0.29
93 0.24
94 0.25
95 0.22
96 0.18
97 0.17
98 0.16
99 0.18
100 0.17
101 0.18
102 0.17
103 0.16
104 0.19
105 0.22
106 0.22
107 0.2
108 0.22
109 0.3
110 0.32
111 0.32
112 0.28
113 0.27
114 0.32
115 0.37
116 0.34
117 0.26
118 0.29
119 0.31
120 0.38
121 0.36
122 0.35
123 0.31
124 0.36
125 0.4
126 0.38
127 0.36
128 0.33
129 0.32
130 0.33
131 0.32
132 0.31
133 0.3
134 0.3
135 0.31
136 0.32
137 0.32
138 0.3
139 0.3
140 0.27
141 0.31
142 0.3
143 0.29
144 0.27
145 0.26
146 0.27
147 0.26
148 0.28
149 0.28
150 0.25
151 0.28
152 0.3
153 0.34
154 0.31
155 0.31
156 0.27
157 0.21
158 0.21
159 0.17
160 0.13
161 0.11
162 0.1
163 0.1
164 0.12
165 0.12
166 0.12
167 0.14
168 0.14
169 0.13
170 0.18
171 0.2
172 0.23
173 0.24
174 0.23
175 0.24
176 0.29
177 0.34
178 0.36
179 0.4
180 0.42
181 0.43
182 0.48
183 0.49
184 0.55
185 0.5
186 0.5
187 0.46
188 0.46
189 0.51
190 0.5
191 0.46
192 0.4
193 0.37
194 0.32
195 0.3
196 0.24
197 0.21
198 0.24
199 0.28
200 0.24
201 0.28
202 0.28
203 0.3
204 0.33
205 0.31
206 0.26
207 0.25
208 0.3
209 0.29
210 0.31
211 0.31
212 0.3
213 0.32
214 0.3
215 0.27
216 0.23
217 0.2
218 0.15
219 0.13
220 0.11
221 0.07
222 0.08
223 0.07
224 0.07
225 0.09
226 0.09
227 0.1
228 0.1
229 0.11
230 0.14
231 0.16
232 0.2
233 0.27
234 0.37
235 0.4
236 0.4
237 0.39
238 0.36
239 0.38
240 0.35
241 0.37
242 0.31
243 0.3
244 0.32
245 0.35
246 0.37
247 0.35
248 0.37
249 0.33
250 0.38
251 0.38
252 0.41
253 0.44
254 0.42
255 0.42
256 0.44
257 0.39
258 0.35
259 0.41
260 0.39
261 0.34
262 0.33
263 0.3
264 0.26
265 0.25
266 0.24
267 0.2
268 0.21
269 0.22
270 0.23
271 0.24
272 0.23
273 0.22
274 0.18
275 0.16
276 0.11
277 0.1
278 0.09
279 0.08
280 0.09
281 0.1
282 0.1
283 0.15
284 0.15
285 0.14
286 0.15
287 0.14
288 0.13
289 0.13
290 0.13
291 0.08
292 0.08
293 0.07
294 0.05
295 0.05
296 0.05
297 0.05
298 0.04
299 0.04
300 0.03
301 0.04
302 0.05
303 0.05
304 0.06
305 0.07
306 0.1
307 0.19
308 0.26
309 0.29
310 0.31
311 0.41
312 0.44
313 0.45
314 0.45
315 0.37
316 0.31
317 0.28
318 0.29
319 0.19
320 0.14
321 0.12
322 0.11
323 0.09
324 0.09
325 0.08
326 0.05
327 0.07
328 0.07
329 0.08
330 0.07
331 0.07
332 0.09
333 0.11
334 0.16
335 0.17
336 0.18
337 0.24
338 0.27
339 0.27
340 0.27
341 0.27
342 0.24
343 0.24
344 0.23
345 0.18
346 0.19
347 0.19
348 0.21
349 0.2
350 0.18
351 0.16
352 0.18
353 0.2
354 0.18
355 0.21
356 0.19
357 0.19
358 0.22
359 0.23
360 0.24
361 0.24
362 0.24
363 0.22
364 0.26
365 0.3
366 0.3
367 0.36
368 0.35
369 0.32
370 0.31
371 0.31
372 0.28
373 0.23
374 0.22
375 0.18
376 0.16
377 0.15
378 0.14
379 0.15
380 0.14
381 0.15
382 0.14
383 0.12
384 0.14
385 0.18
386 0.19
387 0.18
388 0.19
389 0.22
390 0.25
391 0.26
392 0.25
393 0.22
394 0.21
395 0.21
396 0.19
397 0.15
398 0.11
399 0.09
400 0.07
401 0.07
402 0.06
403 0.04
404 0.04
405 0.05
406 0.05
407 0.06
408 0.08
409 0.08
410 0.09
411 0.09
412 0.11
413 0.16
414 0.19
415 0.19
416 0.18
417 0.19
418 0.21
419 0.24
420 0.28
421 0.28
422 0.28
423 0.31
424 0.33
425 0.34
426 0.36
427 0.39
428 0.36
429 0.33
430 0.36
431 0.39
432 0.44
433 0.5
434 0.47
435 0.4
436 0.4
437 0.37
438 0.32
439 0.29
440 0.23
441 0.17
442 0.17
443 0.16
444 0.14
445 0.15
446 0.15
447 0.13
448 0.15
449 0.17
450 0.19
451 0.19
452 0.2
453 0.2
454 0.2
455 0.19
456 0.18
457 0.16
458 0.17
459 0.18
460 0.18
461 0.19
462 0.21
463 0.24
464 0.28
465 0.29
466 0.28
467 0.26
468 0.28
469 0.27
470 0.24
471 0.3
472 0.26
473 0.27
474 0.31
475 0.34
476 0.31
477 0.33
478 0.37
479 0.29
480 0.31
481 0.35
482 0.33
483 0.37
484 0.4
485 0.4
486 0.43
487 0.44
488 0.4
489 0.34
490 0.31
491 0.26
492 0.23
493 0.22
494 0.2
495 0.17
496 0.19
497 0.2
498 0.21
499 0.22
500 0.21
501 0.2
502 0.19
503 0.19
504 0.22
505 0.25
506 0.27
507 0.28
508 0.31
509 0.34
510 0.33
511 0.32
512 0.28
513 0.29
514 0.27
515 0.26
516 0.25
517 0.22
518 0.22
519 0.25