FuNGI

G4N7T3

Protein Details

Accession

G4N7T3

Localization Confidence

Low

Confidence Score

8.2

NoLS Segment(s)

Position	Sequence	Protein Nature
1-23	MPSLGFLKKKRTRDGNNDNSSQP	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

cyto_nucl 12.5, nucl 12, cyto 9, pero 4

Family & Domain DBs

InterPro	View protein in InterPro IPR000961 AGC-kinase_C IPR011009 Kinase-like_dom_sf IPR000719 Prot_kinase_dom IPR017441 Protein_kinase_ATP_BS IPR008271 Ser/Thr_kinase_AS
Gene Ontology	GO:0005952 C:cAMP-dependent protein kinase complex GO:0005829 C:cytosol GO:0000324 C:fungal-type vacuole GO:0005634 C:nucleus GO:0005524 F:ATP binding GO:0004691 F:cAMP-dependent protein kinase activity GO:0010619 P:adenylate cyclase-activating glucose-activated G protein-coupled receptor signaling pathway GO:0045721 P:negative regulation of gluconeogenesis GO:0010515 P:negative regulation of induction of conjugation with cellular fusion GO:0000122 P:negative regulation of transcription by RNA polymerase II GO:0051094 P:positive regulation of developmental process GO:0046827 P:positive regulation of protein export from nucleus GO:0006468 P:protein phosphorylation
KEGG	mgr:MGG_06368 -
Pfam	View protein in Pfam PF00069 Pkinase
PROSITE	View protein in PROSITE PS51285 AGC_KINASE_CTER PS00107 PROTEIN_KINASE_ATP PS50011 PROTEIN_KINASE_DOM PS00108 PROTEIN_KINASE_ST
CDD	cd05580 STKc_PKA_like

Amino Acid Sequences

MPSLGFLKKKRTRDGNNDNSSQPASPVTPTAAQSFEQAQVLGAPSAINNSHAHTQQQSYLVPQPGYSVGTEVQAQQPQMNSISQQQQQAFAPPAHTPSPGTIDPQQSLPSISNLMNPAVQQQNSQPSANFQPQSQSQSQSQSQFPLPPSHGNGDQSQQQNFQVQQQIQSQQDAMDIQPSQVQDQSHSQQAQPQHQPQHHVQHHVNHAHQGSQDQQTRVTKGKYSLTDFEILRTLGTGSFGRVHLVQSRHNQRFYAVKVLKKAQVVKMKQVEHTNDERKMLGEVKNPFLITLWGTFQDCRNLYMVMDFVEGGELFSLLRKSGRFPNPVAKFYAAEVTLALEYLHAKNIIYRDLKPENLLLDRHGHLKITDFGFAKRVPDKTWTLCGTPDYLAPEVVSNKGYNKSVDWWSLGILIYEMLCGYTPFWDSGSPMKIYENILKGKVRYPAYINPDAQDLLQRLITADLTKRLGNLYGGSQDVRNHPWFAEVTWDRLARKDIDAPYTPPVKAGAGDASQFDRYPEETERYGQTGHDEYGNLFPGF

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.86
2	0.86
3	0.86
4	0.82
5	0.73
6	0.66
7	0.58
8	0.47
9	0.37
10	0.29
11	0.23
12	0.2
13	0.21
14	0.21
15	0.22
16	0.23
17	0.25
18	0.24
19	0.22
20	0.24
21	0.25
22	0.23
23	0.2
24	0.18
25	0.16
26	0.15
27	0.16
28	0.13
29	0.11
30	0.09
31	0.08
32	0.11
33	0.11
34	0.12
35	0.12
36	0.15
37	0.2
38	0.21
39	0.24
40	0.25
41	0.27
42	0.28
43	0.31
44	0.28
45	0.28
46	0.33
47	0.35
48	0.31
49	0.29
50	0.27
51	0.25
52	0.25
53	0.21
54	0.17
55	0.13
56	0.14
57	0.15
58	0.15
59	0.18
60	0.19
61	0.2
62	0.2
63	0.2
64	0.21
65	0.22
66	0.2
67	0.17
68	0.21
69	0.27
70	0.29
71	0.34
72	0.33
73	0.34
74	0.34
75	0.36
76	0.34
77	0.27
78	0.26
79	0.21
80	0.24
81	0.23
82	0.23
83	0.2
84	0.19
85	0.24
86	0.22
87	0.25
88	0.27
89	0.29
90	0.29
91	0.3
92	0.29
93	0.24
94	0.25
95	0.22
96	0.18
97	0.17
98	0.16
99	0.18
100	0.17
101	0.18
102	0.17
103	0.16
104	0.19
105	0.22
106	0.22
107	0.2
108	0.22
109	0.3
110	0.32
111	0.32
112	0.28
113	0.27
114	0.32
115	0.37
116	0.34
117	0.26
118	0.29
119	0.31
120	0.38
121	0.36
122	0.35
123	0.31
124	0.36
125	0.4
126	0.38
127	0.36
128	0.33
129	0.32
130	0.33
131	0.32
132	0.31
133	0.3
134	0.3
135	0.31
136	0.32
137	0.32
138	0.3
139	0.3
140	0.27
141	0.31
142	0.3
143	0.29
144	0.27
145	0.26
146	0.27
147	0.26
148	0.28
149	0.28
150	0.25
151	0.28
152	0.3
153	0.34
154	0.31
155	0.31
156	0.27
157	0.21
158	0.21
159	0.17
160	0.13
161	0.11
162	0.1
163	0.1
164	0.12
165	0.12
166	0.12
167	0.14
168	0.14
169	0.13
170	0.18
171	0.2
172	0.23
173	0.24
174	0.23
175	0.24
176	0.29
177	0.34
178	0.36
179	0.4
180	0.42
181	0.43
182	0.48
183	0.49
184	0.55
185	0.5
186	0.5
187	0.46
188	0.46
189	0.51
190	0.5
191	0.46
192	0.4
193	0.37
194	0.32
195	0.3
196	0.24
197	0.21
198	0.24
199	0.28
200	0.24
201	0.28
202	0.28
203	0.3
204	0.33
205	0.31
206	0.26
207	0.25
208	0.3
209	0.29
210	0.31
211	0.31
212	0.3
213	0.32
214	0.3
215	0.27
216	0.23
217	0.2
218	0.15
219	0.13
220	0.11
221	0.07
222	0.08
223	0.07
224	0.07
225	0.09
226	0.09
227	0.1
228	0.1
229	0.11
230	0.14
231	0.16
232	0.2
233	0.27
234	0.37
235	0.4
236	0.4
237	0.39
238	0.36
239	0.38
240	0.35
241	0.37
242	0.31
243	0.3
244	0.32
245	0.35
246	0.37
247	0.35
248	0.37
249	0.33
250	0.38
251	0.38
252	0.41
253	0.44
254	0.42
255	0.42
256	0.44
257	0.39
258	0.35
259	0.41
260	0.39
261	0.34
262	0.33
263	0.3
264	0.26
265	0.25
266	0.24
267	0.2
268	0.21
269	0.22
270	0.23
271	0.24
272	0.23
273	0.22
274	0.18
275	0.16
276	0.11
277	0.1
278	0.09
279	0.08
280	0.09
281	0.1
282	0.1
283	0.15
284	0.15
285	0.14
286	0.15
287	0.14
288	0.13
289	0.13
290	0.13
291	0.08
292	0.08
293	0.07
294	0.05
295	0.05
296	0.05
297	0.05
298	0.04
299	0.04
300	0.03
301	0.04
302	0.05
303	0.05
304	0.06
305	0.07
306	0.1
307	0.19
308	0.26
309	0.29
310	0.31
311	0.41
312	0.44
313	0.45
314	0.45
315	0.37
316	0.31
317	0.28
318	0.29
319	0.19
320	0.14
321	0.12
322	0.11
323	0.09
324	0.09
325	0.08
326	0.05
327	0.07
328	0.07
329	0.08
330	0.07
331	0.07
332	0.09
333	0.11
334	0.16
335	0.17
336	0.18
337	0.24
338	0.27
339	0.27
340	0.27
341	0.27
342	0.24
343	0.24
344	0.23
345	0.18
346	0.19
347	0.19
348	0.21
349	0.2
350	0.18
351	0.16
352	0.18
353	0.2
354	0.18
355	0.21
356	0.19
357	0.19
358	0.22
359	0.23
360	0.24
361	0.24
362	0.24
363	0.22
364	0.26
365	0.3
366	0.3
367	0.36
368	0.35
369	0.32
370	0.31
371	0.31
372	0.28
373	0.23
374	0.22
375	0.18
376	0.16
377	0.15
378	0.14
379	0.15
380	0.14
381	0.15
382	0.14
383	0.12
384	0.14
385	0.18
386	0.19
387	0.18
388	0.19
389	0.22
390	0.25
391	0.26
392	0.25
393	0.22
394	0.21
395	0.21
396	0.19
397	0.15
398	0.11
399	0.09
400	0.07
401	0.07
402	0.06
403	0.04
404	0.04
405	0.05
406	0.05
407	0.06
408	0.08
409	0.08
410	0.09
411	0.09
412	0.11
413	0.16
414	0.19
415	0.19
416	0.18
417	0.19
418	0.21
419	0.24
420	0.28
421	0.28
422	0.28
423	0.31
424	0.33
425	0.34
426	0.36
427	0.39
428	0.36
429	0.33
430	0.36
431	0.39
432	0.44
433	0.5
434	0.47
435	0.4
436	0.4
437	0.37
438	0.32
439	0.29
440	0.23
441	0.17
442	0.17
443	0.16
444	0.14
445	0.15
446	0.15
447	0.13
448	0.15
449	0.17
450	0.19
451	0.19
452	0.2
453	0.2
454	0.2
455	0.19
456	0.18
457	0.16
458	0.17
459	0.18
460	0.18
461	0.19
462	0.21
463	0.24
464	0.28
465	0.29
466	0.28
467	0.26
468	0.28
469	0.27
470	0.24
471	0.3
472	0.26
473	0.27
474	0.31
475	0.34
476	0.31
477	0.33
478	0.37
479	0.29
480	0.31
481	0.35
482	0.33
483	0.37
484	0.4
485	0.4
486	0.43
487	0.44
488	0.4
489	0.34
490	0.31
491	0.26
492	0.23
493	0.22
494	0.2
495	0.17
496	0.19
497	0.2
498	0.21
499	0.22
500	0.21
501	0.2
502	0.19
503	0.19
504	0.22
505	0.25
506	0.27
507	0.28
508	0.31
509	0.34
510	0.33
511	0.32
512	0.28
513	0.29
514	0.27
515	0.26
516	0.25
517	0.22
518	0.22
519	0.25

G4N7T3

3D AlphaFold-predicted Structure Viewer