Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4MZ91

Protein Details
Accession G4MZ91    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
104-127AAPAQWGKKARRRQRQVVRKILEDHydrophilic
NLS Segment(s)
PositionSequence
111-117KKARRRQ
Subcellular Location(s) mito 8, cyto_nucl 7, nucl 6.5, cyto 6.5, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011431  Trafficking_Pga2  
Gene Ontology GO:0016020  C:membrane  
KEGG mgr:MGG_08195  -  
Pfam View protein in Pfam  
PF07543  PGA2  
Amino Acid Sequences MDGLYNMATLVKDRVRNNLGNSLSQMSAQQWIRLITAICAYLLVRPYLVSLAGKVQMKQMEKEEARAEAEAAEQRAKMSPNEFRGQQIAGVPEDTDDEEDGEPAAPAQWGKKARRRQRQVVRKILEDHEQKLADQAGDDEDKDIEEFLVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.38
3 0.42
4 0.45
5 0.48
6 0.46
7 0.41
8 0.42
9 0.36
10 0.31
11 0.27
12 0.24
13 0.16
14 0.21
15 0.2
16 0.18
17 0.18
18 0.18
19 0.18
20 0.19
21 0.18
22 0.12
23 0.13
24 0.12
25 0.1
26 0.09
27 0.09
28 0.1
29 0.1
30 0.09
31 0.08
32 0.08
33 0.08
34 0.08
35 0.09
36 0.07
37 0.06
38 0.08
39 0.12
40 0.13
41 0.13
42 0.15
43 0.19
44 0.2
45 0.22
46 0.22
47 0.26
48 0.26
49 0.28
50 0.26
51 0.23
52 0.22
53 0.2
54 0.18
55 0.1
56 0.11
57 0.09
58 0.09
59 0.09
60 0.08
61 0.08
62 0.09
63 0.1
64 0.1
65 0.12
66 0.15
67 0.19
68 0.22
69 0.22
70 0.21
71 0.22
72 0.21
73 0.19
74 0.16
75 0.13
76 0.11
77 0.11
78 0.1
79 0.08
80 0.09
81 0.08
82 0.07
83 0.06
84 0.07
85 0.07
86 0.07
87 0.07
88 0.07
89 0.06
90 0.05
91 0.06
92 0.05
93 0.05
94 0.06
95 0.12
96 0.19
97 0.26
98 0.35
99 0.45
100 0.55
101 0.66
102 0.74
103 0.79
104 0.83
105 0.87
106 0.89
107 0.89
108 0.83
109 0.77
110 0.73
111 0.66
112 0.63
113 0.57
114 0.49
115 0.45
116 0.41
117 0.36
118 0.34
119 0.32
120 0.23
121 0.19
122 0.18
123 0.15
124 0.16
125 0.16
126 0.14
127 0.13
128 0.13
129 0.13
130 0.13