Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G4MYP6

Protein Details
Accession G4MYP6    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
27-48VLCSRQKGVKPQRTKTPLKASGHydrophilic
64-96PATARDKLKAKIRRRKFTPRSRGQKQENNKMKDHydrophilic
282-307KECTVYFCFKKRRRADMQFLKKAQKMHydrophilic
NLS Segment(s)
PositionSequence
69-88DKLKAKIRRRKFTPRSRGQK
Subcellular Location(s) mito 18.5, cyto_mito 12, cyto 4.5, nucl 2, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR033684  EFM6  
IPR019410  Methyltransf_16  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0016279  F:protein-lysine N-methyltransferase activity  
GO:0018022  P:peptidyl-lysine methylation  
KEGG mgr:MGG_01349  -  
Pfam View protein in Pfam  
PF10294  Methyltransf_16  
Amino Acid Sequences MHYFIGRSISQNLLFAQNGSCHSQSFVLCSRQKGVKPQRTKTPLKASGLIGLTTQLTALIFTTPATARDKLKAKIRRRKFTPRSRGQKQENNKMKDIINDRSSSPPVFSPLAIDADLAPLPEYKAAGETKINFGGLLPATAPLRLHEDLSSGCGGQLWPAGMVLATHMLRDRRSSIGRERILELGAGGGLVSLAVARGCDVETPMLITDQLEMLALMEHNIRLNEVEDKAKALILNWGEPLPQQVVELKPTVVLAADCVYFEPAFPLLLQTLTDLLALSPPKECTVYFCFKKRRRADMQFLKKAQKMFSVVEVPDQDRPVFSRQNLFLYAIISKEEAIKVTTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.21
4 0.19
5 0.21
6 0.24
7 0.24
8 0.2
9 0.22
10 0.24
11 0.23
12 0.25
13 0.28
14 0.33
15 0.35
16 0.37
17 0.42
18 0.45
19 0.48
20 0.53
21 0.59
22 0.6
23 0.66
24 0.71
25 0.76
26 0.78
27 0.82
28 0.81
29 0.81
30 0.78
31 0.73
32 0.7
33 0.61
34 0.58
35 0.52
36 0.42
37 0.31
38 0.25
39 0.2
40 0.15
41 0.14
42 0.08
43 0.06
44 0.06
45 0.06
46 0.06
47 0.06
48 0.06
49 0.09
50 0.09
51 0.12
52 0.16
53 0.18
54 0.2
55 0.27
56 0.33
57 0.36
58 0.45
59 0.53
60 0.59
61 0.67
62 0.75
63 0.78
64 0.81
65 0.87
66 0.88
67 0.89
68 0.9
69 0.9
70 0.9
71 0.88
72 0.9
73 0.87
74 0.86
75 0.84
76 0.84
77 0.83
78 0.79
79 0.72
80 0.66
81 0.57
82 0.55
83 0.51
84 0.47
85 0.42
86 0.37
87 0.37
88 0.38
89 0.39
90 0.32
91 0.28
92 0.21
93 0.21
94 0.2
95 0.18
96 0.16
97 0.15
98 0.16
99 0.14
100 0.14
101 0.1
102 0.1
103 0.11
104 0.09
105 0.08
106 0.06
107 0.07
108 0.07
109 0.07
110 0.05
111 0.08
112 0.09
113 0.1
114 0.12
115 0.13
116 0.15
117 0.16
118 0.16
119 0.13
120 0.12
121 0.13
122 0.11
123 0.1
124 0.07
125 0.08
126 0.08
127 0.08
128 0.08
129 0.07
130 0.12
131 0.12
132 0.13
133 0.11
134 0.13
135 0.12
136 0.14
137 0.14
138 0.08
139 0.08
140 0.07
141 0.07
142 0.06
143 0.07
144 0.05
145 0.05
146 0.05
147 0.05
148 0.04
149 0.04
150 0.04
151 0.06
152 0.05
153 0.05
154 0.07
155 0.09
156 0.09
157 0.11
158 0.13
159 0.14
160 0.16
161 0.2
162 0.25
163 0.33
164 0.35
165 0.35
166 0.34
167 0.31
168 0.29
169 0.25
170 0.18
171 0.09
172 0.07
173 0.06
174 0.04
175 0.02
176 0.02
177 0.02
178 0.02
179 0.02
180 0.02
181 0.02
182 0.02
183 0.02
184 0.03
185 0.03
186 0.04
187 0.04
188 0.05
189 0.05
190 0.06
191 0.06
192 0.06
193 0.05
194 0.05
195 0.05
196 0.05
197 0.05
198 0.04
199 0.04
200 0.04
201 0.04
202 0.04
203 0.04
204 0.05
205 0.05
206 0.06
207 0.06
208 0.06
209 0.06
210 0.08
211 0.1
212 0.11
213 0.13
214 0.12
215 0.14
216 0.14
217 0.14
218 0.13
219 0.1
220 0.14
221 0.13
222 0.14
223 0.13
224 0.13
225 0.13
226 0.13
227 0.14
228 0.11
229 0.1
230 0.09
231 0.12
232 0.13
233 0.15
234 0.16
235 0.14
236 0.13
237 0.13
238 0.12
239 0.09
240 0.08
241 0.07
242 0.07
243 0.07
244 0.07
245 0.07
246 0.09
247 0.08
248 0.08
249 0.09
250 0.08
251 0.08
252 0.08
253 0.09
254 0.08
255 0.08
256 0.08
257 0.07
258 0.08
259 0.08
260 0.08
261 0.07
262 0.06
263 0.09
264 0.1
265 0.1
266 0.11
267 0.12
268 0.14
269 0.15
270 0.15
271 0.17
272 0.24
273 0.33
274 0.37
275 0.45
276 0.55
277 0.61
278 0.72
279 0.74
280 0.77
281 0.78
282 0.81
283 0.84
284 0.84
285 0.88
286 0.87
287 0.85
288 0.82
289 0.75
290 0.69
291 0.6
292 0.55
293 0.48
294 0.4
295 0.4
296 0.38
297 0.35
298 0.36
299 0.38
300 0.34
301 0.34
302 0.34
303 0.29
304 0.25
305 0.28
306 0.29
307 0.32
308 0.32
309 0.36
310 0.37
311 0.41
312 0.42
313 0.4
314 0.35
315 0.3
316 0.29
317 0.21
318 0.2
319 0.16
320 0.14
321 0.15
322 0.16
323 0.15