Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4MZB6

Protein Details
Accession G4MZB6   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
2-23VWFDQTTKTKKKKMTDASNDACHydrophilic
83-109DGSRCLTQVTRRPRRRRQPLVSGTFFFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, cyto_nucl 7, nucl 6.5, cyto 6.5, pero 3
Family & Domain DBs
KEGG mgr:MGG_15530  -  
Amino Acid Sequences MVWFDQTTKTKKKKMTDASNDACSSGAVRSTASVSRLGLFQGVPEEADKAGCKVELAQNYRYYGPIIGIYAVSKTKPCGPSLDGSRCLTQVTRRPRRRRQPLVSGTFFFRCRLLPLFVNQPPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.81
3 0.81
4 0.82
5 0.8
6 0.78
7 0.69
8 0.59
9 0.48
10 0.37
11 0.28
12 0.19
13 0.14
14 0.09
15 0.08
16 0.09
17 0.11
18 0.13
19 0.13
20 0.13
21 0.13
22 0.13
23 0.13
24 0.13
25 0.11
26 0.09
27 0.08
28 0.08
29 0.08
30 0.07
31 0.07
32 0.08
33 0.07
34 0.08
35 0.08
36 0.07
37 0.07
38 0.07
39 0.06
40 0.07
41 0.11
42 0.16
43 0.2
44 0.22
45 0.24
46 0.25
47 0.26
48 0.24
49 0.21
50 0.15
51 0.12
52 0.09
53 0.08
54 0.06
55 0.06
56 0.06
57 0.06
58 0.07
59 0.07
60 0.07
61 0.08
62 0.14
63 0.16
64 0.16
65 0.19
66 0.21
67 0.26
68 0.34
69 0.38
70 0.36
71 0.37
72 0.37
73 0.34
74 0.33
75 0.28
76 0.27
77 0.29
78 0.36
79 0.45
80 0.55
81 0.65
82 0.75
83 0.84
84 0.89
85 0.92
86 0.89
87 0.9
88 0.89
89 0.88
90 0.82
91 0.73
92 0.67
93 0.6
94 0.52
95 0.42
96 0.33
97 0.26
98 0.25
99 0.26
100 0.26
101 0.25
102 0.29
103 0.37