Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G4NAG4

Protein Details
Accession G4NAG4   
Localization Confidence Low
Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
48-71LTFRGCRSSSRSTKRRRCSCRHTSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 9.5, cyto 6.5, extr 5, mito 4
Family & Domain DBs
KEGG mgr:MGG_17276  -  
Amino Acid Sequences MALSRVDGLSLCRTVLALAVLDVTNKNQDALISVLFNARRSLVRSEELTFRGCRSSSRSTKRRRCSCRHTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.1
4 0.06
5 0.06
6 0.07
7 0.07
8 0.07
9 0.08
10 0.08
11 0.09
12 0.09
13 0.09
14 0.08
15 0.08
16 0.09
17 0.09
18 0.09
19 0.07
20 0.07
21 0.09
22 0.1
23 0.1
24 0.09
25 0.09
26 0.1
27 0.12
28 0.15
29 0.16
30 0.18
31 0.2
32 0.22
33 0.25
34 0.25
35 0.25
36 0.23
37 0.21
38 0.22
39 0.2
40 0.2
41 0.23
42 0.31
43 0.39
44 0.49
45 0.57
46 0.66
47 0.76
48 0.84
49 0.89
50 0.89
51 0.89