Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q753X0

Protein Details
Accession Q753X0    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
16-41LWKIPWRMSAPQKQRQRRRLQAVDDVHydrophilic
106-133KSSRGYRKGAHKVPKWTKVSNRRNPANFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
KEGG ago:AGOS_AFR202W  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFKSSQPLLGGLLWKIPWRMSAPQKQRQRRRLQAVDDVLKQLNLGLQIRKKLQSLPDLPFDALKQERVKKCVDIKQLRLLNDPAVFPAEHQMSPKDKYTVFNKSSRGYRKGAHKVPKWTKVSNRRNPANF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.19
4 0.18
5 0.17
6 0.16
7 0.17
8 0.19
9 0.26
10 0.33
11 0.43
12 0.5
13 0.59
14 0.69
15 0.76
16 0.83
17 0.85
18 0.86
19 0.86
20 0.87
21 0.85
22 0.8
23 0.78
24 0.75
25 0.7
26 0.6
27 0.53
28 0.43
29 0.35
30 0.29
31 0.2
32 0.14
33 0.11
34 0.12
35 0.13
36 0.16
37 0.2
38 0.22
39 0.24
40 0.24
41 0.24
42 0.26
43 0.29
44 0.31
45 0.31
46 0.32
47 0.31
48 0.3
49 0.28
50 0.24
51 0.2
52 0.16
53 0.17
54 0.17
55 0.24
56 0.26
57 0.28
58 0.3
59 0.31
60 0.37
61 0.4
62 0.46
63 0.45
64 0.47
65 0.53
66 0.55
67 0.51
68 0.48
69 0.42
70 0.35
71 0.3
72 0.26
73 0.18
74 0.16
75 0.14
76 0.11
77 0.15
78 0.14
79 0.14
80 0.15
81 0.18
82 0.2
83 0.23
84 0.26
85 0.24
86 0.23
87 0.27
88 0.32
89 0.38
90 0.39
91 0.42
92 0.43
93 0.45
94 0.53
95 0.56
96 0.55
97 0.49
98 0.5
99 0.56
100 0.62
101 0.66
102 0.67
103 0.67
104 0.73
105 0.79
106 0.83
107 0.79
108 0.76
109 0.78
110 0.79
111 0.83
112 0.83
113 0.83