Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179U2J3

Protein Details
Accession A0A179U2J3    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
33-60PGHLNRTRWSRKRGQRHRRTNRSSLTDGHydrophilic
NLS Segment(s)
PositionSequence
42-51SRKRGQRHRR
Subcellular Location(s) nucl 21, cyto_nucl 13, cyto 3
Family & Domain DBs
Amino Acid Sequences MTDFSKAEISDNIQVQTKQTLSTQCLGTGDHFPGHLNRTRWSRKRGQRHRRTNRSSLTDGPQSMARLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.25
4 0.22
5 0.18
6 0.18
7 0.2
8 0.2
9 0.24
10 0.23
11 0.2
12 0.2
13 0.19
14 0.18
15 0.16
16 0.15
17 0.12
18 0.11
19 0.11
20 0.12
21 0.14
22 0.17
23 0.17
24 0.2
25 0.28
26 0.37
27 0.43
28 0.49
29 0.56
30 0.61
31 0.71
32 0.78
33 0.81
34 0.83
35 0.88
36 0.92
37 0.93
38 0.92
39 0.9
40 0.87
41 0.83
42 0.77
43 0.71
44 0.66
45 0.61
46 0.54
47 0.47
48 0.41