Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7TEA4

Protein Details
Accession A7TEA4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
73-93RRKGRVYVYCKSNKKHKQRQGBasic
NLS Segment(s)
Subcellular Location(s) mito 24.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG vpo:Kpol_1002p73  -  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MLRASFGIPFVRACSSLSRSQLAGASSILQRASLFPMARSLLNSSNLITPAFTRGFKVKTAVKKFCSDCYIVRRKGRVYVYCKSNKKHKQRQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.23
3 0.28
4 0.3
5 0.29
6 0.27
7 0.28
8 0.29
9 0.24
10 0.2
11 0.15
12 0.14
13 0.13
14 0.13
15 0.12
16 0.1
17 0.1
18 0.09
19 0.12
20 0.13
21 0.13
22 0.12
23 0.15
24 0.15
25 0.16
26 0.16
27 0.15
28 0.14
29 0.16
30 0.16
31 0.15
32 0.14
33 0.15
34 0.14
35 0.11
36 0.09
37 0.1
38 0.11
39 0.11
40 0.11
41 0.14
42 0.16
43 0.16
44 0.2
45 0.23
46 0.31
47 0.4
48 0.44
49 0.45
50 0.5
51 0.51
52 0.52
53 0.5
54 0.43
55 0.39
56 0.43
57 0.49
58 0.5
59 0.54
60 0.54
61 0.53
62 0.58
63 0.6
64 0.59
65 0.57
66 0.58
67 0.62
68 0.67
69 0.72
70 0.71
71 0.74
72 0.76
73 0.8