Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6H0G9

Protein Details
Accession B6H0G9    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-29ACTYSGQGKNRQRKRTSLRIKIEQNWFHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 5.5, cyto_nucl 4
Family & Domain DBs
KEGG pcs:Pc12g10290  -  
Amino Acid Sequences MACTYSGQGKNRQRKRTSLRIKIEQNWFHRLIKDFLFKAIISMNGRASDRCPFMARERLVDPEDDAALWVTIEFPEAMKFTHTDEQLMDWVVHQIGHAETSTSASAQHYQRHLCLSLPVVGIPRGEEHNDAVRDQAKTLAQWWHAEIMTGRIYLDRSVIFP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.8
3 0.81
4 0.82
5 0.82
6 0.82
7 0.81
8 0.84
9 0.82
10 0.83
11 0.79
12 0.73
13 0.69
14 0.64
15 0.56
16 0.53
17 0.48
18 0.41
19 0.38
20 0.4
21 0.34
22 0.32
23 0.32
24 0.27
25 0.25
26 0.23
27 0.22
28 0.17
29 0.18
30 0.18
31 0.18
32 0.19
33 0.19
34 0.19
35 0.2
36 0.2
37 0.2
38 0.2
39 0.2
40 0.24
41 0.32
42 0.31
43 0.3
44 0.29
45 0.31
46 0.3
47 0.27
48 0.23
49 0.16
50 0.15
51 0.11
52 0.1
53 0.07
54 0.06
55 0.05
56 0.04
57 0.04
58 0.03
59 0.04
60 0.04
61 0.04
62 0.05
63 0.05
64 0.05
65 0.06
66 0.06
67 0.09
68 0.13
69 0.13
70 0.13
71 0.13
72 0.13
73 0.13
74 0.13
75 0.11
76 0.07
77 0.07
78 0.07
79 0.06
80 0.05
81 0.06
82 0.05
83 0.06
84 0.06
85 0.05
86 0.06
87 0.07
88 0.08
89 0.07
90 0.07
91 0.08
92 0.13
93 0.15
94 0.2
95 0.22
96 0.23
97 0.25
98 0.27
99 0.26
100 0.22
101 0.21
102 0.18
103 0.18
104 0.17
105 0.16
106 0.15
107 0.15
108 0.15
109 0.14
110 0.14
111 0.12
112 0.14
113 0.15
114 0.16
115 0.22
116 0.23
117 0.22
118 0.24
119 0.25
120 0.24
121 0.23
122 0.25
123 0.19
124 0.18
125 0.22
126 0.25
127 0.23
128 0.24
129 0.25
130 0.25
131 0.24
132 0.25
133 0.22
134 0.2
135 0.2
136 0.18
137 0.17
138 0.14
139 0.16
140 0.15
141 0.17