Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6GY77

Protein Details
Accession B6GY77    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
129-149VLDPKRHYKKENGKAKPPEYSBasic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 14.5, cyto 11.5, nucl 10.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039883  Fcf2/DNTTIP2  
IPR014810  Fcf2_C  
Gene Ontology GO:0005634  C:nucleus  
KEGG pcs:Pc12g04660  -  
Pfam View protein in Pfam  
PF08698  Fcf2  
Amino Acid Sequences MADSTCVGVQENLTDDQIQQLLLEAEARLKGPNALTTQNDDLASLRIPKLSPGSSLEAYIRQGDDVATVDAAKIVDQKQKELANSLRVAGIKKVNTDKPTAGPEWFNLPKTEMTTELKRDLQLIRMRSVLDPKRHYKKENGKAKPPEYSQQSHHQEGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.15
4 0.15
5 0.13
6 0.1
7 0.09
8 0.09
9 0.08
10 0.09
11 0.07
12 0.08
13 0.09
14 0.09
15 0.09
16 0.09
17 0.11
18 0.11
19 0.15
20 0.17
21 0.19
22 0.2
23 0.25
24 0.26
25 0.26
26 0.25
27 0.21
28 0.19
29 0.17
30 0.17
31 0.14
32 0.12
33 0.12
34 0.12
35 0.13
36 0.16
37 0.15
38 0.16
39 0.17
40 0.22
41 0.2
42 0.22
43 0.21
44 0.18
45 0.18
46 0.18
47 0.14
48 0.09
49 0.09
50 0.08
51 0.08
52 0.07
53 0.06
54 0.05
55 0.05
56 0.05
57 0.06
58 0.06
59 0.05
60 0.06
61 0.08
62 0.12
63 0.12
64 0.13
65 0.17
66 0.18
67 0.18
68 0.21
69 0.2
70 0.21
71 0.21
72 0.21
73 0.18
74 0.18
75 0.18
76 0.17
77 0.19
78 0.15
79 0.18
80 0.23
81 0.26
82 0.27
83 0.29
84 0.28
85 0.27
86 0.3
87 0.28
88 0.25
89 0.21
90 0.2
91 0.25
92 0.25
93 0.24
94 0.2
95 0.21
96 0.21
97 0.22
98 0.23
99 0.19
100 0.21
101 0.25
102 0.28
103 0.3
104 0.3
105 0.28
106 0.29
107 0.27
108 0.29
109 0.3
110 0.3
111 0.28
112 0.28
113 0.29
114 0.28
115 0.37
116 0.37
117 0.4
118 0.44
119 0.52
120 0.61
121 0.66
122 0.68
123 0.69
124 0.73
125 0.75
126 0.78
127 0.77
128 0.77
129 0.81
130 0.81
131 0.78
132 0.72
133 0.71
134 0.67
135 0.64
136 0.59
137 0.6
138 0.62