Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6HU51

Protein Details
Accession B6HU51    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
208-233LNKAYASYKKGKKKASKEKGRAISPSHydrophilic
NLS Segment(s)
PositionSequence
216-259KKGKKKASKEKGRAISPSKAPINPITIPPAKDKGKGKAIPASAS
272-277KSIKKR
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, mito 4
Family & Domain DBs
KEGG pcs:Pc22g18150  -  
Amino Acid Sequences MEYGNDSDYILPNRIGKRSSVSRRSREGAQKLPLDPGKVSLITVYRGINKGNTLIKEGASKIFRRSLYKRLSESLGTTRSFTTTARGSIKPIDTKPRRNTKVTKSGKVDISKFPSPLSSLKALGGIGGDSDSNSDSDSDSNSSAAGSNSGIASGNSSVGGNNSSVGVGTVIAGPAGIGKGARGIVTTPVITNYSGDRSLNRRYYKAPLNKAYASYKKGKKKASKEKGRAISPSKAPINPITIPPAKDKGKGKAIPASASLAKAGSAITTPSKSIKKRTASNAPSGKDKGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.32
3 0.3
4 0.35
5 0.44
6 0.52
7 0.56
8 0.62
9 0.65
10 0.71
11 0.73
12 0.74
13 0.74
14 0.72
15 0.69
16 0.67
17 0.65
18 0.59
19 0.63
20 0.56
21 0.49
22 0.41
23 0.36
24 0.31
25 0.26
26 0.25
27 0.2
28 0.19
29 0.18
30 0.2
31 0.19
32 0.2
33 0.21
34 0.22
35 0.22
36 0.21
37 0.25
38 0.27
39 0.26
40 0.27
41 0.26
42 0.26
43 0.27
44 0.27
45 0.28
46 0.27
47 0.27
48 0.27
49 0.32
50 0.34
51 0.38
52 0.42
53 0.45
54 0.5
55 0.55
56 0.54
57 0.51
58 0.51
59 0.45
60 0.44
61 0.41
62 0.37
63 0.31
64 0.29
65 0.26
66 0.24
67 0.23
68 0.2
69 0.18
70 0.16
71 0.19
72 0.23
73 0.23
74 0.24
75 0.27
76 0.31
77 0.32
78 0.33
79 0.4
80 0.43
81 0.52
82 0.59
83 0.65
84 0.66
85 0.68
86 0.73
87 0.72
88 0.75
89 0.73
90 0.72
91 0.66
92 0.67
93 0.65
94 0.62
95 0.56
96 0.5
97 0.49
98 0.44
99 0.39
100 0.34
101 0.28
102 0.26
103 0.24
104 0.22
105 0.18
106 0.16
107 0.16
108 0.16
109 0.15
110 0.13
111 0.11
112 0.07
113 0.05
114 0.04
115 0.04
116 0.03
117 0.04
118 0.04
119 0.04
120 0.05
121 0.05
122 0.05
123 0.06
124 0.07
125 0.07
126 0.07
127 0.07
128 0.07
129 0.07
130 0.07
131 0.07
132 0.06
133 0.05
134 0.05
135 0.05
136 0.05
137 0.05
138 0.04
139 0.05
140 0.05
141 0.05
142 0.05
143 0.05
144 0.05
145 0.05
146 0.06
147 0.05
148 0.05
149 0.05
150 0.05
151 0.05
152 0.05
153 0.04
154 0.04
155 0.04
156 0.04
157 0.04
158 0.03
159 0.03
160 0.03
161 0.03
162 0.03
163 0.03
164 0.02
165 0.03
166 0.04
167 0.04
168 0.05
169 0.05
170 0.05
171 0.07
172 0.09
173 0.09
174 0.08
175 0.09
176 0.1
177 0.1
178 0.1
179 0.1
180 0.11
181 0.12
182 0.13
183 0.14
184 0.18
185 0.25
186 0.33
187 0.34
188 0.34
189 0.36
190 0.42
191 0.49
192 0.54
193 0.55
194 0.53
195 0.56
196 0.55
197 0.56
198 0.57
199 0.53
200 0.49
201 0.5
202 0.53
203 0.56
204 0.62
205 0.68
206 0.7
207 0.75
208 0.82
209 0.84
210 0.86
211 0.86
212 0.88
213 0.87
214 0.82
215 0.78
216 0.72
217 0.68
218 0.61
219 0.6
220 0.54
221 0.47
222 0.46
223 0.41
224 0.41
225 0.35
226 0.33
227 0.33
228 0.33
229 0.34
230 0.35
231 0.4
232 0.38
233 0.43
234 0.46
235 0.47
236 0.53
237 0.54
238 0.54
239 0.53
240 0.53
241 0.49
242 0.45
243 0.42
244 0.34
245 0.31
246 0.27
247 0.2
248 0.17
249 0.15
250 0.13
251 0.08
252 0.07
253 0.09
254 0.13
255 0.14
256 0.16
257 0.22
258 0.3
259 0.35
260 0.43
261 0.5
262 0.55
263 0.62
264 0.7
265 0.74
266 0.72
267 0.77
268 0.76
269 0.7
270 0.69