Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6H3L3

Protein Details
Accession B6H3L3    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
98-128IPKVSFRCQRGQKYRDRRRKREDGTPLRNTTHydrophilic
NLS Segment(s)
PositionSequence
115-116RR
Subcellular Location(s) extr 14, plas 5, mito 4, nucl 3
Family & Domain DBs
KEGG pcs:Pc13g13430  -  
Amino Acid Sequences METPLLPAFLPALYILPAFINLNRVLTAMPSTETTPESGTRPATQPATGPTWGMLPPPVNDRSFGTIEEAIDWIGEWAATQGYGISKGHSWRNTQGLIPKVSFRCQRGQKYRDRRRKREDGTPLRNTTHLATNCPFAGELCFDFISRRYIITRITEHLHNHEGAPPSAWTSHRQREMRRRKAEIASLIDQNIPNRVILQHSRSLAGAAGTASYLSAKTIENFRYKYHQEKLAGFTPLQAASPLPSSQAPQPAPQPAPQPALQPPPPPALQPPPPPALQQHLNHHLHQHLNQHLHQHLNRTSTTTSTTTSTGTWTSTSTSTSTGTSTNTSTSTSTVSQPTPQPASQPAPQPAPQPAPQPAPQPAPQPAPQPAPQPAPQPAPQPAPRPAPQPAPRPALHPAPQPALQGASPEPTYAGSPVTTQHSQSTTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.08
4 0.09
5 0.1
6 0.11
7 0.14
8 0.14
9 0.15
10 0.15
11 0.15
12 0.14
13 0.14
14 0.15
15 0.12
16 0.13
17 0.13
18 0.14
19 0.16
20 0.17
21 0.17
22 0.18
23 0.19
24 0.2
25 0.22
26 0.23
27 0.25
28 0.27
29 0.31
30 0.3
31 0.29
32 0.29
33 0.3
34 0.32
35 0.28
36 0.26
37 0.21
38 0.21
39 0.21
40 0.2
41 0.18
42 0.15
43 0.17
44 0.22
45 0.26
46 0.24
47 0.25
48 0.27
49 0.29
50 0.28
51 0.27
52 0.26
53 0.23
54 0.23
55 0.22
56 0.2
57 0.14
58 0.12
59 0.11
60 0.07
61 0.06
62 0.05
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.05
69 0.06
70 0.09
71 0.09
72 0.1
73 0.12
74 0.16
75 0.24
76 0.27
77 0.3
78 0.33
79 0.38
80 0.38
81 0.39
82 0.41
83 0.4
84 0.39
85 0.36
86 0.38
87 0.35
88 0.4
89 0.43
90 0.4
91 0.44
92 0.49
93 0.59
94 0.63
95 0.68
96 0.72
97 0.78
98 0.85
99 0.87
100 0.89
101 0.89
102 0.89
103 0.92
104 0.87
105 0.85
106 0.86
107 0.85
108 0.84
109 0.82
110 0.76
111 0.67
112 0.62
113 0.53
114 0.44
115 0.41
116 0.33
117 0.29
118 0.26
119 0.27
120 0.26
121 0.25
122 0.22
123 0.14
124 0.14
125 0.11
126 0.11
127 0.11
128 0.11
129 0.11
130 0.12
131 0.12
132 0.15
133 0.13
134 0.14
135 0.13
136 0.15
137 0.17
138 0.2
139 0.22
140 0.21
141 0.24
142 0.26
143 0.26
144 0.29
145 0.29
146 0.25
147 0.23
148 0.25
149 0.24
150 0.2
151 0.19
152 0.15
153 0.14
154 0.16
155 0.16
156 0.17
157 0.22
158 0.29
159 0.36
160 0.41
161 0.48
162 0.57
163 0.67
164 0.73
165 0.73
166 0.71
167 0.69
168 0.68
169 0.64
170 0.58
171 0.52
172 0.44
173 0.38
174 0.34
175 0.29
176 0.26
177 0.22
178 0.19
179 0.14
180 0.11
181 0.1
182 0.1
183 0.11
184 0.14
185 0.17
186 0.18
187 0.18
188 0.19
189 0.18
190 0.18
191 0.15
192 0.13
193 0.09
194 0.06
195 0.05
196 0.04
197 0.04
198 0.04
199 0.04
200 0.03
201 0.03
202 0.04
203 0.04
204 0.06
205 0.1
206 0.14
207 0.18
208 0.2
209 0.21
210 0.26
211 0.29
212 0.34
213 0.34
214 0.36
215 0.35
216 0.36
217 0.39
218 0.37
219 0.36
220 0.29
221 0.26
222 0.22
223 0.19
224 0.16
225 0.12
226 0.08
227 0.07
228 0.09
229 0.08
230 0.08
231 0.08
232 0.1
233 0.12
234 0.18
235 0.19
236 0.19
237 0.21
238 0.25
239 0.26
240 0.27
241 0.28
242 0.25
243 0.28
244 0.27
245 0.27
246 0.26
247 0.31
248 0.3
249 0.29
250 0.28
251 0.29
252 0.28
253 0.26
254 0.26
255 0.26
256 0.3
257 0.34
258 0.36
259 0.35
260 0.36
261 0.36
262 0.34
263 0.33
264 0.34
265 0.32
266 0.35
267 0.41
268 0.43
269 0.43
270 0.43
271 0.41
272 0.37
273 0.36
274 0.36
275 0.32
276 0.34
277 0.35
278 0.37
279 0.36
280 0.39
281 0.37
282 0.38
283 0.36
284 0.35
285 0.33
286 0.32
287 0.31
288 0.26
289 0.28
290 0.23
291 0.21
292 0.19
293 0.2
294 0.18
295 0.17
296 0.18
297 0.15
298 0.14
299 0.13
300 0.12
301 0.13
302 0.13
303 0.14
304 0.13
305 0.14
306 0.14
307 0.14
308 0.15
309 0.13
310 0.14
311 0.15
312 0.15
313 0.15
314 0.14
315 0.15
316 0.15
317 0.15
318 0.16
319 0.16
320 0.18
321 0.2
322 0.21
323 0.23
324 0.26
325 0.31
326 0.32
327 0.31
328 0.31
329 0.32
330 0.36
331 0.37
332 0.4
333 0.39
334 0.4
335 0.41
336 0.42
337 0.42
338 0.42
339 0.41
340 0.37
341 0.38
342 0.38
343 0.39
344 0.39
345 0.39
346 0.39
347 0.39
348 0.39
349 0.39
350 0.39
351 0.39
352 0.39
353 0.39
354 0.39
355 0.39
356 0.39
357 0.39
358 0.39
359 0.39
360 0.39
361 0.39
362 0.39
363 0.39
364 0.39
365 0.39
366 0.42
367 0.44
368 0.47
369 0.49
370 0.51
371 0.51
372 0.53
373 0.53
374 0.55
375 0.57
376 0.6
377 0.61
378 0.6
379 0.57
380 0.56
381 0.57
382 0.55
383 0.53
384 0.51
385 0.49
386 0.48
387 0.49
388 0.47
389 0.43
390 0.36
391 0.31
392 0.27
393 0.23
394 0.22
395 0.2
396 0.18
397 0.18
398 0.16
399 0.17
400 0.15
401 0.15
402 0.12
403 0.12
404 0.15
405 0.21
406 0.22
407 0.23
408 0.27