Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5GG15

Protein Details
Accession C5GG15    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
9-36DLSRRRSTSSTSSRRRSRSRDRYSTISSHydrophilic
NLS Segment(s)
PositionSequence
83-100RAKPRSGFIARTVRKIRR
Subcellular Location(s) plas 12, nucl 4, mito 4, mito_nucl 4, cyto 2, pero 2, E.R. 2, cyto_pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDWLYPFSDLSRRRSTSSTSSRRRSRSRDRYSTISSRHSGSHSRSKSHSSPSLFNLGGHANRSTASAASIFSVGSAASSSSRRAKPRSGFIARTVRKIRRLFRHILRYARSHPLKVFFMVVMPLITGGVLQKLLSVVGVRLPPLLGGGHGAGFRGGNGGVGGGGLGGMLGGGGGGLGGSVGGLMSLAKMFV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.5
3 0.52
4 0.58
5 0.62
6 0.62
7 0.69
8 0.75
9 0.81
10 0.84
11 0.83
12 0.84
13 0.84
14 0.85
15 0.85
16 0.83
17 0.81
18 0.8
19 0.78
20 0.72
21 0.67
22 0.58
23 0.5
24 0.46
25 0.42
26 0.4
27 0.39
28 0.44
29 0.41
30 0.43
31 0.44
32 0.49
33 0.49
34 0.51
35 0.51
36 0.45
37 0.45
38 0.44
39 0.47
40 0.4
41 0.36
42 0.31
43 0.26
44 0.23
45 0.21
46 0.18
47 0.13
48 0.13
49 0.14
50 0.12
51 0.1
52 0.09
53 0.08
54 0.08
55 0.08
56 0.08
57 0.07
58 0.06
59 0.06
60 0.05
61 0.04
62 0.04
63 0.04
64 0.05
65 0.06
66 0.09
67 0.15
68 0.2
69 0.24
70 0.27
71 0.34
72 0.37
73 0.43
74 0.5
75 0.48
76 0.46
77 0.48
78 0.56
79 0.5
80 0.52
81 0.51
82 0.46
83 0.49
84 0.53
85 0.53
86 0.52
87 0.57
88 0.57
89 0.58
90 0.64
91 0.61
92 0.61
93 0.57
94 0.52
95 0.51
96 0.53
97 0.47
98 0.4
99 0.36
100 0.35
101 0.33
102 0.3
103 0.27
104 0.17
105 0.15
106 0.14
107 0.12
108 0.08
109 0.06
110 0.05
111 0.04
112 0.04
113 0.04
114 0.03
115 0.04
116 0.04
117 0.04
118 0.04
119 0.04
120 0.04
121 0.05
122 0.05
123 0.04
124 0.07
125 0.08
126 0.08
127 0.08
128 0.08
129 0.08
130 0.09
131 0.08
132 0.06
133 0.06
134 0.07
135 0.08
136 0.08
137 0.08
138 0.07
139 0.07
140 0.07
141 0.07
142 0.06
143 0.05
144 0.05
145 0.05
146 0.05
147 0.05
148 0.05
149 0.03
150 0.03
151 0.02
152 0.02
153 0.02
154 0.02
155 0.01
156 0.01
157 0.01
158 0.01
159 0.01
160 0.01
161 0.01
162 0.01
163 0.01
164 0.01
165 0.02
166 0.02
167 0.02
168 0.02
169 0.02
170 0.02
171 0.03