Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6HIK3

Protein Details
Accession B6HIK3    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
127-148RAYGNFKRKERKPQTTSRKEGDBasic
NLS Segment(s)
PositionSequence
213-220DKKKKKRK
Subcellular Location(s) nucl 21, mito 4
Family & Domain DBs
KEGG pcs:Pc21g14670  -  
Amino Acid Sequences MSGSSSPAGKPEKTMSSNLLTMKFMRRAAAAKETQSPSSDDSPHNSKRPRLSTEAESPRTSDMEAITAALAAEEEKRQQAVARAAAEAGETHWVLDVPAMPQSTQQPVVLAADSLDAEDDTYSGGRRAYGNFKRKERKPQTTSRKEGDEDDEDEDEDTIINPSNPQEVTKMMEKARLKAEAKARGSSRQTKLSELTSISGSGRGSLLGAPSSDKKKKKRKSC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.39
3 0.39
4 0.42
5 0.41
6 0.38
7 0.31
8 0.31
9 0.34
10 0.35
11 0.31
12 0.29
13 0.28
14 0.29
15 0.32
16 0.38
17 0.35
18 0.33
19 0.4
20 0.41
21 0.4
22 0.38
23 0.36
24 0.31
25 0.32
26 0.33
27 0.27
28 0.3
29 0.36
30 0.41
31 0.47
32 0.47
33 0.49
34 0.54
35 0.59
36 0.59
37 0.57
38 0.56
39 0.54
40 0.59
41 0.63
42 0.58
43 0.52
44 0.48
45 0.43
46 0.38
47 0.32
48 0.23
49 0.14
50 0.11
51 0.11
52 0.1
53 0.08
54 0.07
55 0.07
56 0.05
57 0.05
58 0.04
59 0.05
60 0.05
61 0.06
62 0.07
63 0.07
64 0.08
65 0.09
66 0.13
67 0.16
68 0.18
69 0.18
70 0.18
71 0.18
72 0.17
73 0.16
74 0.11
75 0.08
76 0.07
77 0.06
78 0.06
79 0.06
80 0.06
81 0.05
82 0.06
83 0.06
84 0.05
85 0.07
86 0.07
87 0.07
88 0.08
89 0.1
90 0.12
91 0.12
92 0.12
93 0.1
94 0.1
95 0.11
96 0.09
97 0.08
98 0.06
99 0.05
100 0.05
101 0.04
102 0.04
103 0.03
104 0.03
105 0.03
106 0.03
107 0.03
108 0.03
109 0.04
110 0.04
111 0.05
112 0.05
113 0.06
114 0.09
115 0.18
116 0.27
117 0.36
118 0.42
119 0.51
120 0.59
121 0.64
122 0.73
123 0.73
124 0.75
125 0.73
126 0.78
127 0.8
128 0.81
129 0.82
130 0.75
131 0.69
132 0.6
133 0.55
134 0.49
135 0.42
136 0.34
137 0.3
138 0.26
139 0.22
140 0.21
141 0.18
142 0.13
143 0.09
144 0.08
145 0.06
146 0.06
147 0.06
148 0.06
149 0.07
150 0.1
151 0.1
152 0.11
153 0.12
154 0.13
155 0.16
156 0.2
157 0.24
158 0.22
159 0.29
160 0.3
161 0.32
162 0.35
163 0.39
164 0.36
165 0.38
166 0.46
167 0.47
168 0.49
169 0.51
170 0.5
171 0.5
172 0.55
173 0.59
174 0.56
175 0.55
176 0.54
177 0.52
178 0.52
179 0.47
180 0.44
181 0.36
182 0.32
183 0.25
184 0.24
185 0.2
186 0.2
187 0.17
188 0.14
189 0.13
190 0.11
191 0.1
192 0.1
193 0.11
194 0.1
195 0.1
196 0.13
197 0.2
198 0.29
199 0.37
200 0.45
201 0.54
202 0.64