Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6HVX7

Protein Details
Accession B6HVX7   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
14-38SDLRGENEKKKQKRARSGKHLYAESHydrophilic
NLS Segment(s)
PositionSequence
22-31KKKQKRARSG
Subcellular Location(s) cyto 15, cyto_nucl 12.333, nucl 7.5, mito_nucl 6.666
Family & Domain DBs
KEGG pcs:Pc22g10670  -  
Amino Acid Sequences MTMQSAALLEREVSDLRGENEKKKQKRARSGKHLYAESGLSVQEASVLITQPVEAAEPGPGQHGWPLACGGHSLVKYVIKVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.14
4 0.23
5 0.25
6 0.29
7 0.39
8 0.48
9 0.52
10 0.62
11 0.68
12 0.69
13 0.77
14 0.82
15 0.83
16 0.83
17 0.86
18 0.83
19 0.81
20 0.72
21 0.61
22 0.52
23 0.41
24 0.3
25 0.22
26 0.14
27 0.08
28 0.07
29 0.05
30 0.04
31 0.04
32 0.04
33 0.05
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.05
41 0.04
42 0.04
43 0.05
44 0.06
45 0.06
46 0.08
47 0.08
48 0.08
49 0.09
50 0.12
51 0.11
52 0.11
53 0.13
54 0.11
55 0.11
56 0.12
57 0.12
58 0.15
59 0.15
60 0.16
61 0.17
62 0.2