Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6H024

Protein Details
Accession B6H024    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
405-427DQKEESKPAPVRRSKRSAKGNKAHydrophilic
NLS Segment(s)
PositionSequence
189-197GPKGPPEKG
411-427KPAPVRRSKRSAKGNKA
Subcellular Location(s) extr 6, mito 5, cyto 4, plas 4, E.R. 3, nucl 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR040115  Lnp  
IPR019273  Lunapark_dom  
Gene Ontology GO:0098826  C:endoplasmic reticulum tubular network membrane  
GO:0046872  F:metal ion binding  
GO:0071788  P:endoplasmic reticulum tubular network maintenance  
GO:1903373  P:positive regulation of endoplasmic reticulum tubular network organization  
KEGG pcs:Pc12g13690  -  
Pfam View protein in Pfam  
PF10058  zinc_ribbon_10  
Amino Acid Sequences MWPLNSRAPSSQFIGILCMYNNGFFLALEGEIHCFYLFRFTAADFIQGDDNSAASFEKTLSTLSTKIAEATTRLDQQRQSSRRIKALWTLYSTFAYLFYSIILALVLGWESWGIKEYAAIAGGPVLIYGVRTLSSRVFDYRISRLQRRLDDFHKQREETIEKLKVATKYNSTQQLLEKYGGESPKPSPGPKGPPEKGKPAQQPQHVARTGLPPPPTANIRRPPSASQTQNDPPSPGYPSPPIELAQGGPQTPQQSSPQPPFPPQTPTDQASFAPNAFPPQSGEQPHWYDRLLDVLLGEDETQPRNRMVMMCSACRLVNGQAPPGIKTPEELGRWRCGNCKAWNGVESETTKILSSLRQDGPPEGTWEPVSKAEADTQSSEGMEEGVMVASSEEEQVDFIGSDAEDQKEESKPAPVRRSKRSAKGNKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.27
3 0.24
4 0.2
5 0.2
6 0.17
7 0.16
8 0.16
9 0.13
10 0.12
11 0.1
12 0.11
13 0.09
14 0.09
15 0.09
16 0.09
17 0.11
18 0.11
19 0.12
20 0.11
21 0.09
22 0.09
23 0.16
24 0.16
25 0.15
26 0.16
27 0.15
28 0.2
29 0.2
30 0.24
31 0.16
32 0.17
33 0.2
34 0.18
35 0.2
36 0.16
37 0.15
38 0.11
39 0.12
40 0.11
41 0.08
42 0.08
43 0.07
44 0.08
45 0.08
46 0.09
47 0.11
48 0.14
49 0.15
50 0.16
51 0.18
52 0.17
53 0.17
54 0.18
55 0.17
56 0.15
57 0.19
58 0.21
59 0.26
60 0.28
61 0.3
62 0.32
63 0.39
64 0.48
65 0.47
66 0.52
67 0.53
68 0.57
69 0.6
70 0.6
71 0.55
72 0.53
73 0.56
74 0.52
75 0.48
76 0.45
77 0.4
78 0.38
79 0.35
80 0.27
81 0.21
82 0.17
83 0.12
84 0.1
85 0.08
86 0.07
87 0.07
88 0.06
89 0.06
90 0.04
91 0.04
92 0.04
93 0.04
94 0.03
95 0.03
96 0.03
97 0.04
98 0.04
99 0.05
100 0.05
101 0.05
102 0.06
103 0.07
104 0.07
105 0.07
106 0.07
107 0.06
108 0.06
109 0.06
110 0.05
111 0.04
112 0.03
113 0.03
114 0.03
115 0.04
116 0.04
117 0.04
118 0.05
119 0.07
120 0.09
121 0.11
122 0.12
123 0.14
124 0.15
125 0.17
126 0.21
127 0.25
128 0.3
129 0.34
130 0.38
131 0.42
132 0.47
133 0.51
134 0.53
135 0.53
136 0.51
137 0.56
138 0.57
139 0.6
140 0.6
141 0.54
142 0.49
143 0.51
144 0.49
145 0.42
146 0.43
147 0.38
148 0.32
149 0.33
150 0.35
151 0.32
152 0.33
153 0.32
154 0.29
155 0.28
156 0.33
157 0.39
158 0.36
159 0.34
160 0.34
161 0.35
162 0.33
163 0.3
164 0.25
165 0.19
166 0.21
167 0.2
168 0.17
169 0.15
170 0.14
171 0.2
172 0.21
173 0.21
174 0.22
175 0.26
176 0.34
177 0.39
178 0.47
179 0.43
180 0.51
181 0.54
182 0.58
183 0.57
184 0.58
185 0.59
186 0.58
187 0.61
188 0.56
189 0.6
190 0.54
191 0.58
192 0.51
193 0.43
194 0.36
195 0.34
196 0.32
197 0.29
198 0.27
199 0.19
200 0.19
201 0.21
202 0.23
203 0.22
204 0.26
205 0.31
206 0.34
207 0.35
208 0.37
209 0.37
210 0.4
211 0.44
212 0.41
213 0.34
214 0.37
215 0.4
216 0.41
217 0.39
218 0.34
219 0.27
220 0.25
221 0.27
222 0.21
223 0.19
224 0.18
225 0.19
226 0.19
227 0.19
228 0.19
229 0.15
230 0.15
231 0.13
232 0.13
233 0.12
234 0.11
235 0.11
236 0.12
237 0.13
238 0.13
239 0.14
240 0.14
241 0.19
242 0.23
243 0.27
244 0.32
245 0.32
246 0.35
247 0.36
248 0.35
249 0.35
250 0.32
251 0.35
252 0.33
253 0.33
254 0.31
255 0.29
256 0.28
257 0.25
258 0.25
259 0.18
260 0.15
261 0.13
262 0.14
263 0.14
264 0.14
265 0.13
266 0.15
267 0.2
268 0.2
269 0.23
270 0.26
271 0.3
272 0.31
273 0.3
274 0.27
275 0.24
276 0.22
277 0.23
278 0.17
279 0.13
280 0.11
281 0.1
282 0.1
283 0.09
284 0.09
285 0.07
286 0.08
287 0.11
288 0.13
289 0.13
290 0.14
291 0.14
292 0.15
293 0.15
294 0.16
295 0.22
296 0.23
297 0.23
298 0.24
299 0.25
300 0.24
301 0.22
302 0.22
303 0.16
304 0.18
305 0.18
306 0.19
307 0.21
308 0.22
309 0.23
310 0.24
311 0.23
312 0.18
313 0.18
314 0.19
315 0.22
316 0.25
317 0.29
318 0.3
319 0.34
320 0.38
321 0.38
322 0.4
323 0.4
324 0.45
325 0.45
326 0.49
327 0.47
328 0.47
329 0.48
330 0.45
331 0.41
332 0.38
333 0.34
334 0.29
335 0.25
336 0.22
337 0.2
338 0.18
339 0.17
340 0.16
341 0.18
342 0.23
343 0.26
344 0.28
345 0.3
346 0.32
347 0.36
348 0.34
349 0.35
350 0.27
351 0.26
352 0.24
353 0.25
354 0.24
355 0.21
356 0.21
357 0.18
358 0.18
359 0.22
360 0.23
361 0.24
362 0.24
363 0.24
364 0.23
365 0.22
366 0.21
367 0.15
368 0.13
369 0.09
370 0.07
371 0.06
372 0.05
373 0.05
374 0.05
375 0.05
376 0.05
377 0.06
378 0.06
379 0.06
380 0.06
381 0.06
382 0.06
383 0.07
384 0.07
385 0.06
386 0.07
387 0.07
388 0.1
389 0.12
390 0.13
391 0.13
392 0.14
393 0.17
394 0.19
395 0.21
396 0.2
397 0.27
398 0.33
399 0.41
400 0.51
401 0.57
402 0.63
403 0.7
404 0.79
405 0.8
406 0.83
407 0.85