Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6HB21

Protein Details
Accession B6HB21   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPPLSRVKREQLRKRRNNLLRRHNEFWLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, mito_nucl 13.333, cyto_nucl 10.833, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
KEGG pcs:Pc17g01010  -  
Amino Acid Sequences MAPPLSRVKREQLRKRRNNLLRRHNEFWLLYGMKSWLIMELPDGQIFTYHSHPDTPPPSREDMKTRSKPTIVRTPRDYISATSAQSVGRDIPVFCAPVRQDQKWEALANHLNNNRRMVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.88
3 0.89
4 0.89
5 0.88
6 0.87
7 0.87
8 0.87
9 0.85
10 0.81
11 0.72
12 0.67
13 0.58
14 0.49
15 0.45
16 0.35
17 0.26
18 0.23
19 0.2
20 0.16
21 0.15
22 0.13
23 0.08
24 0.07
25 0.07
26 0.07
27 0.09
28 0.1
29 0.1
30 0.1
31 0.09
32 0.09
33 0.1
34 0.11
35 0.11
36 0.11
37 0.11
38 0.13
39 0.14
40 0.18
41 0.22
42 0.24
43 0.23
44 0.25
45 0.28
46 0.28
47 0.3
48 0.31
49 0.33
50 0.39
51 0.44
52 0.45
53 0.44
54 0.45
55 0.47
56 0.46
57 0.51
58 0.47
59 0.45
60 0.47
61 0.48
62 0.46
63 0.45
64 0.41
65 0.31
66 0.31
67 0.28
68 0.23
69 0.2
70 0.2
71 0.17
72 0.16
73 0.16
74 0.11
75 0.1
76 0.11
77 0.1
78 0.13
79 0.14
80 0.15
81 0.14
82 0.19
83 0.19
84 0.28
85 0.34
86 0.32
87 0.36
88 0.37
89 0.42
90 0.41
91 0.43
92 0.33
93 0.34
94 0.4
95 0.38
96 0.44
97 0.45
98 0.47
99 0.48