Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6H660

Protein Details
Accession B6H660   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
12-35ADAVNQKARRRRKSLFRKASQYSSHydrophilic
NLS Segment(s)
PositionSequence
18-25KARRRRKS
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
KEGG pcs:Pc14g02350  -  
Pfam View protein in Pfam  
PF00319  SRF-TF  
Amino Acid Sequences MDVQPKLRTNPADAVNQKARRRRKSLFRKASQYSSECDADIHLVLRMKKSGKIFVLASNTKDWPLSQHQLVSSLGHRFCCEKGINLITRGLITLHPFKCLQATQGPSRESPPY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.52
3 0.57
4 0.59
5 0.61
6 0.67
7 0.67
8 0.73
9 0.74
10 0.76
11 0.79
12 0.84
13 0.86
14 0.84
15 0.84
16 0.81
17 0.79
18 0.73
19 0.64
20 0.55
21 0.49
22 0.41
23 0.32
24 0.27
25 0.21
26 0.16
27 0.14
28 0.12
29 0.09
30 0.11
31 0.11
32 0.12
33 0.15
34 0.15
35 0.18
36 0.2
37 0.23
38 0.21
39 0.23
40 0.23
41 0.23
42 0.28
43 0.25
44 0.25
45 0.22
46 0.22
47 0.2
48 0.19
49 0.15
50 0.13
51 0.18
52 0.2
53 0.19
54 0.2
55 0.2
56 0.22
57 0.23
58 0.2
59 0.16
60 0.18
61 0.18
62 0.17
63 0.18
64 0.17
65 0.17
66 0.21
67 0.2
68 0.17
69 0.22
70 0.27
71 0.29
72 0.29
73 0.29
74 0.25
75 0.24
76 0.22
77 0.17
78 0.13
79 0.14
80 0.21
81 0.21
82 0.23
83 0.24
84 0.24
85 0.27
86 0.27
87 0.26
88 0.25
89 0.31
90 0.36
91 0.42
92 0.44
93 0.41