Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6GWK7

Protein Details
Accession B6GWK7    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
17-46AERLYFKPKVSKPRGRRRRRHGDCGPSFSPBasic
NLS Segment(s)
PositionSequence
22-37FKPKVSKPRGRRRRRH
Subcellular Location(s) nucl 19, cyto_nucl 11.5, mito 6
Family & Domain DBs
KEGG pcs:Pc09g00110  -  
Amino Acid Sequences MIRMRLSQPCKIRPRDAERLYFKPKVSKPRGRRRRRHGDCGPSFSPIFHLRVNPRGLSEVATREMRRSVLLRLHLNRREHDRALLRDLDCRQSTRTDPTTQTIQQVLRTRTIAELYDDFRRMTVEPIDIRGATDRVLERNRHTADRPILANIGAVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.78
3 0.76
4 0.76
5 0.73
6 0.75
7 0.74
8 0.69
9 0.62
10 0.61
11 0.61
12 0.62
13 0.65
14 0.68
15 0.71
16 0.77
17 0.86
18 0.88
19 0.92
20 0.92
21 0.93
22 0.91
23 0.91
24 0.89
25 0.89
26 0.84
27 0.81
28 0.72
29 0.64
30 0.55
31 0.44
32 0.39
33 0.31
34 0.27
35 0.21
36 0.25
37 0.24
38 0.3
39 0.33
40 0.29
41 0.27
42 0.26
43 0.25
44 0.23
45 0.21
46 0.17
47 0.18
48 0.2
49 0.2
50 0.19
51 0.2
52 0.17
53 0.17
54 0.16
55 0.16
56 0.17
57 0.21
58 0.25
59 0.29
60 0.36
61 0.4
62 0.41
63 0.4
64 0.44
65 0.44
66 0.39
67 0.4
68 0.37
69 0.33
70 0.34
71 0.36
72 0.29
73 0.29
74 0.3
75 0.3
76 0.26
77 0.25
78 0.23
79 0.22
80 0.24
81 0.26
82 0.29
83 0.28
84 0.29
85 0.31
86 0.34
87 0.33
88 0.33
89 0.3
90 0.27
91 0.29
92 0.34
93 0.32
94 0.3
95 0.29
96 0.27
97 0.25
98 0.26
99 0.21
100 0.17
101 0.17
102 0.17
103 0.21
104 0.21
105 0.2
106 0.19
107 0.2
108 0.17
109 0.18
110 0.17
111 0.18
112 0.18
113 0.21
114 0.23
115 0.21
116 0.21
117 0.21
118 0.19
119 0.15
120 0.18
121 0.17
122 0.21
123 0.27
124 0.3
125 0.32
126 0.41
127 0.44
128 0.45
129 0.46
130 0.49
131 0.49
132 0.51
133 0.48
134 0.42
135 0.39
136 0.34