Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6HFT3

Protein Details
Accession B6HFT3   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
58-87GRTLELAKKKKKEKRKRRINTQRQKQIEIPBasic
NLS Segment(s)
PositionSequence
64-76AKKKKKEKRKRRI
Subcellular Location(s) nucl 13, mito 12
Family & Domain DBs
KEGG pcs:Pc20g10380  -  
Amino Acid Sequences MQLNILEIFYLVRFKNGLSRQSGSEYSVSVQPSFVPNHDERKSELGNNPDLGMCPSPGRTLELAKKKKKEKRKRRINTQRQKQIEIPKVWSICDGTHLFSIPSITRQTNRVPGRVIGPCVTAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.21
3 0.26
4 0.3
5 0.32
6 0.34
7 0.35
8 0.39
9 0.4
10 0.33
11 0.29
12 0.25
13 0.21
14 0.22
15 0.21
16 0.16
17 0.15
18 0.14
19 0.16
20 0.16
21 0.15
22 0.18
23 0.19
24 0.27
25 0.29
26 0.3
27 0.29
28 0.33
29 0.34
30 0.32
31 0.34
32 0.29
33 0.29
34 0.28
35 0.26
36 0.21
37 0.19
38 0.17
39 0.14
40 0.1
41 0.09
42 0.09
43 0.09
44 0.09
45 0.11
46 0.1
47 0.13
48 0.2
49 0.29
50 0.37
51 0.43
52 0.5
53 0.57
54 0.65
55 0.72
56 0.77
57 0.78
58 0.81
59 0.86
60 0.89
61 0.92
62 0.95
63 0.95
64 0.95
65 0.94
66 0.93
67 0.86
68 0.8
69 0.75
70 0.73
71 0.7
72 0.62
73 0.55
74 0.51
75 0.47
76 0.43
77 0.38
78 0.3
79 0.21
80 0.24
81 0.2
82 0.17
83 0.17
84 0.18
85 0.16
86 0.15
87 0.17
88 0.13
89 0.15
90 0.17
91 0.19
92 0.21
93 0.24
94 0.3
95 0.37
96 0.4
97 0.41
98 0.4
99 0.39
100 0.44
101 0.45
102 0.43
103 0.35