Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6HSA3

Protein Details
Accession B6HSA3   
Localization Confidence High
Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-22SEFAKERRRKARAFELQRRSHydrophilic
NLS Segment(s)
PositionSequence
7-49KERRRKARAFELQRRSASPARASQASPRQRSPWPEPPRPRSPR
116-120PPRVK
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
KEGG pcs:Pc22g08380  -  
Amino Acid Sequences MSSEFAKERRRKARAFELQRRSASPARASQASPRQRSPWPEPPRPRSPRAATLQERARQDSRAAQLAERGLPVNTPSGPSRRGIVPSRQAPFAANRTPPPANKNQARTSPRVKEEPPRVKEEPPRVKEEPSSPPQRPEAAVLPPEKSPENLKKFEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.8
3 0.8
4 0.8
5 0.8
6 0.77
7 0.71
8 0.67
9 0.61
10 0.55
11 0.5
12 0.46
13 0.43
14 0.42
15 0.41
16 0.43
17 0.48
18 0.52
19 0.51
20 0.49
21 0.49
22 0.51
23 0.58
24 0.58
25 0.59
26 0.59
27 0.64
28 0.7
29 0.74
30 0.8
31 0.79
32 0.75
33 0.73
34 0.69
35 0.68
36 0.64
37 0.66
38 0.59
39 0.6
40 0.62
41 0.58
42 0.55
43 0.51
44 0.46
45 0.38
46 0.35
47 0.33
48 0.29
49 0.29
50 0.27
51 0.22
52 0.23
53 0.23
54 0.22
55 0.17
56 0.14
57 0.09
58 0.09
59 0.09
60 0.09
61 0.08
62 0.09
63 0.1
64 0.12
65 0.13
66 0.13
67 0.15
68 0.14
69 0.19
70 0.2
71 0.25
72 0.3
73 0.34
74 0.36
75 0.34
76 0.33
77 0.3
78 0.3
79 0.29
80 0.26
81 0.23
82 0.22
83 0.27
84 0.29
85 0.3
86 0.32
87 0.35
88 0.39
89 0.43
90 0.48
91 0.49
92 0.55
93 0.58
94 0.59
95 0.59
96 0.59
97 0.57
98 0.56
99 0.54
100 0.54
101 0.61
102 0.65
103 0.61
104 0.61
105 0.59
106 0.6
107 0.66
108 0.67
109 0.67
110 0.61
111 0.64
112 0.59
113 0.59
114 0.57
115 0.55
116 0.52
117 0.5
118 0.55
119 0.5
120 0.52
121 0.52
122 0.5
123 0.46
124 0.42
125 0.37
126 0.34
127 0.37
128 0.35
129 0.33
130 0.32
131 0.33
132 0.3
133 0.28
134 0.31
135 0.36
136 0.42