Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6H5X4

Protein Details
Accession B6H5X4    Localization Confidence High Confidence Score 17.7
NoLS Segment(s)
PositionSequenceProtein Nature
57-79QITKAYRKKSRTIHPDKVKRAFIHydrophilic
234-254VAVNRRQKRMMDKENKKDKKGBasic
365-384ETTATSNARSRKRGKRSQRSHydrophilic
NLS Segment(s)
PositionSequence
64-68KKSRT
70-76HPDKVKR
86-86K
88-88K
239-257RQKRMMDKENKKDKKGGAR
373-384RSRKRGKRSQRS
Subcellular Location(s) extr 11, plas 5, E.R. 3, nucl 2, cyto 2, cyto_nucl 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR036869  J_dom_sf  
Gene Ontology GO:0016020  C:membrane  
KEGG pcs:Pc14g01460  -  
Pfam View protein in Pfam  
PF00226  DnaJ  
PROSITE View protein in PROSITE  
PS50076  DNAJ_2  
CDD cd06257  DnaJ  
Amino Acid Sequences MKPFAILSLFVFFGLVAAWSKEDYEIFGLQNDVATNEGANVTFYDLLEIRPNANQEQITKAYRKKSRTIHPDKVKRAFIANYPKDKNKAKSNKGVNVNKGPTQREIDAAVRDADARSARLNLVANVLRGPNRERYDHFLKNGFPLWKGTGYYYSRFRPGLGSVLLGLFLVFGGGAHYAALILGWKRQREFVDRYIRQARRAAWGDEMGVRGISDIDSIAAPPPTAPESGDAGAVAVNRRQKRMMDKENKKDKKGGARVSARASGTSTPTEQPASTGERKRVVAENGKTLIVDSIGNVFLEELNEAGERQEFLLDIDQIGRPTLRETMVCKLPVWCFNKTVGRVLGTSTEEVDSDEAEEPLVEEAETTATSNARSRKRGKRSQRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.07
4 0.07
5 0.08
6 0.09
7 0.1
8 0.11
9 0.11
10 0.12
11 0.14
12 0.16
13 0.15
14 0.16
15 0.16
16 0.15
17 0.16
18 0.14
19 0.11
20 0.1
21 0.09
22 0.08
23 0.08
24 0.09
25 0.08
26 0.08
27 0.08
28 0.09
29 0.1
30 0.1
31 0.12
32 0.12
33 0.13
34 0.18
35 0.18
36 0.18
37 0.19
38 0.22
39 0.21
40 0.25
41 0.25
42 0.22
43 0.27
44 0.3
45 0.33
46 0.36
47 0.41
48 0.46
49 0.52
50 0.55
51 0.58
52 0.62
53 0.68
54 0.73
55 0.77
56 0.78
57 0.82
58 0.87
59 0.87
60 0.86
61 0.79
62 0.7
63 0.64
64 0.56
65 0.53
66 0.54
67 0.53
68 0.54
69 0.55
70 0.59
71 0.61
72 0.66
73 0.64
74 0.64
75 0.67
76 0.66
77 0.7
78 0.74
79 0.76
80 0.78
81 0.79
82 0.75
83 0.74
84 0.69
85 0.65
86 0.61
87 0.55
88 0.49
89 0.46
90 0.39
91 0.32
92 0.32
93 0.29
94 0.26
95 0.24
96 0.21
97 0.17
98 0.17
99 0.15
100 0.14
101 0.12
102 0.12
103 0.12
104 0.12
105 0.12
106 0.14
107 0.15
108 0.13
109 0.17
110 0.17
111 0.16
112 0.16
113 0.18
114 0.16
115 0.17
116 0.2
117 0.23
118 0.24
119 0.27
120 0.29
121 0.35
122 0.42
123 0.44
124 0.44
125 0.39
126 0.38
127 0.37
128 0.39
129 0.33
130 0.26
131 0.23
132 0.23
133 0.21
134 0.21
135 0.19
136 0.21
137 0.22
138 0.25
139 0.28
140 0.28
141 0.29
142 0.29
143 0.28
144 0.23
145 0.21
146 0.21
147 0.17
148 0.15
149 0.12
150 0.12
151 0.11
152 0.09
153 0.08
154 0.04
155 0.03
156 0.03
157 0.02
158 0.02
159 0.02
160 0.03
161 0.03
162 0.03
163 0.03
164 0.03
165 0.03
166 0.03
167 0.03
168 0.03
169 0.07
170 0.1
171 0.11
172 0.12
173 0.16
174 0.18
175 0.23
176 0.28
177 0.33
178 0.42
179 0.41
180 0.46
181 0.53
182 0.52
183 0.48
184 0.47
185 0.4
186 0.37
187 0.39
188 0.34
189 0.26
190 0.25
191 0.23
192 0.21
193 0.2
194 0.12
195 0.09
196 0.08
197 0.06
198 0.06
199 0.05
200 0.04
201 0.03
202 0.04
203 0.04
204 0.04
205 0.05
206 0.05
207 0.05
208 0.05
209 0.06
210 0.07
211 0.07
212 0.07
213 0.08
214 0.11
215 0.11
216 0.11
217 0.1
218 0.09
219 0.09
220 0.09
221 0.08
222 0.09
223 0.15
224 0.16
225 0.18
226 0.2
227 0.23
228 0.32
229 0.41
230 0.5
231 0.54
232 0.63
233 0.72
234 0.81
235 0.84
236 0.77
237 0.73
238 0.67
239 0.67
240 0.66
241 0.62
242 0.6
243 0.6
244 0.61
245 0.59
246 0.58
247 0.48
248 0.4
249 0.34
250 0.27
251 0.23
252 0.21
253 0.2
254 0.17
255 0.18
256 0.19
257 0.17
258 0.16
259 0.16
260 0.21
261 0.26
262 0.3
263 0.32
264 0.35
265 0.36
266 0.38
267 0.4
268 0.4
269 0.41
270 0.4
271 0.42
272 0.39
273 0.39
274 0.36
275 0.31
276 0.25
277 0.17
278 0.14
279 0.08
280 0.08
281 0.09
282 0.09
283 0.08
284 0.08
285 0.07
286 0.08
287 0.07
288 0.05
289 0.06
290 0.06
291 0.06
292 0.07
293 0.07
294 0.07
295 0.08
296 0.08
297 0.07
298 0.08
299 0.11
300 0.1
301 0.1
302 0.12
303 0.13
304 0.13
305 0.14
306 0.12
307 0.1
308 0.12
309 0.15
310 0.15
311 0.16
312 0.19
313 0.25
314 0.3
315 0.31
316 0.3
317 0.31
318 0.34
319 0.4
320 0.41
321 0.37
322 0.33
323 0.38
324 0.45
325 0.44
326 0.46
327 0.4
328 0.38
329 0.35
330 0.35
331 0.33
332 0.28
333 0.26
334 0.22
335 0.19
336 0.17
337 0.17
338 0.16
339 0.12
340 0.12
341 0.12
342 0.11
343 0.1
344 0.1
345 0.09
346 0.1
347 0.1
348 0.07
349 0.06
350 0.06
351 0.08
352 0.08
353 0.09
354 0.09
355 0.1
356 0.12
357 0.18
358 0.25
359 0.32
360 0.4
361 0.49
362 0.58
363 0.69
364 0.78