Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A179TWN5

Protein Details
Accession A0A179TWN5   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MKREREKKSVTANKQQQKKIKKQKLAEKKRIEAHydrophilic
NLS Segment(s)
PositionSequence
5-30REKKSVTANKQQQKKIKKQKLAEKKR
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MKREREKKSVTANKQQQKKIKKQKLAEKKRIEALFRSQMHFIIQNIEKTALLSEHVNLLTAEMKSETADQKIQDFEIQINLTEKKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.82
3 0.8
4 0.79
5 0.82
6 0.82
7 0.82
8 0.83
9 0.82
10 0.85
11 0.88
12 0.89
13 0.88
14 0.85
15 0.78
16 0.77
17 0.71
18 0.63
19 0.55
20 0.5
21 0.49
22 0.42
23 0.4
24 0.33
25 0.3
26 0.29
27 0.27
28 0.2
29 0.16
30 0.16
31 0.15
32 0.15
33 0.15
34 0.14
35 0.13
36 0.13
37 0.08
38 0.08
39 0.07
40 0.07
41 0.09
42 0.09
43 0.09
44 0.08
45 0.09
46 0.1
47 0.1
48 0.1
49 0.08
50 0.09
51 0.09
52 0.12
53 0.13
54 0.14
55 0.16
56 0.17
57 0.19
58 0.2
59 0.2
60 0.19
61 0.18
62 0.16
63 0.19
64 0.19
65 0.18
66 0.21