Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6H516

Protein Details
Accession B6H516    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
42-66KVGRREVEEKKKKPKRTTNPGGEDGBasic
NLS Segment(s)
PositionSequence
43-57VGRREVEEKKKKPKR
Subcellular Location(s) nucl 23, mito 2
Family & Domain DBs
KEGG pcs:Pc13g11830  -  
Amino Acid Sequences MGKDLQTDFPSARKPRNLEVDFKHVGRGSLNPRQAERNEVEKVGRREVEEKKKKPKRTTNPGGEDGMGLYLDYRTRYHPLPSDGDKPINIDFWRGMNQITY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.51
3 0.6
4 0.59
5 0.58
6 0.58
7 0.58
8 0.54
9 0.5
10 0.46
11 0.36
12 0.34
13 0.27
14 0.28
15 0.27
16 0.31
17 0.36
18 0.34
19 0.35
20 0.39
21 0.39
22 0.38
23 0.34
24 0.32
25 0.29
26 0.28
27 0.29
28 0.3
29 0.32
30 0.3
31 0.28
32 0.24
33 0.29
34 0.36
35 0.45
36 0.49
37 0.52
38 0.6
39 0.67
40 0.74
41 0.78
42 0.81
43 0.8
44 0.81
45 0.85
46 0.84
47 0.82
48 0.77
49 0.68
50 0.57
51 0.46
52 0.35
53 0.25
54 0.15
55 0.08
56 0.06
57 0.05
58 0.06
59 0.07
60 0.08
61 0.11
62 0.15
63 0.17
64 0.21
65 0.26
66 0.29
67 0.34
68 0.38
69 0.42
70 0.42
71 0.43
72 0.39
73 0.37
74 0.34
75 0.33
76 0.28
77 0.25
78 0.22
79 0.22
80 0.27
81 0.25