Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6GW35

Protein Details
Accession B6GW35   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
15-41HGPPTQTRYQTRKPTNLQRGQKQNPIHHydrophilic
66-87YGKPTPTKLKRQTPPKPTQANRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, mito 10, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR002777  PFD_beta-like  
IPR016661  PFDN4  
IPR009053  Prefoldin  
Gene Ontology GO:0016272  C:prefoldin complex  
GO:0051082  F:unfolded protein binding  
GO:0006457  P:protein folding  
KEGG pcs:Pc06g00960  -  
Pfam View protein in Pfam  
PF01920  Prefoldin_2  
Amino Acid Sequences MYCIAPIYHQLIATHGPPTQTRYQTRKPTNLQRGQKQNPIHKRTDKFPKTNQIAPHADSQDGAAAYGKPTPTKLKRQTPPKPTQANRKTNAQLTKADEATANDENEVRREDQEKINRFSRLHQRETVLEEQLKGKQKDKEDLEEVSMELELADEDELVPYKIGDSFFQLPLSDAQGMLSTSTEKIDADVSKLEDSLGELREEMQQLKVALYARFGRSINLET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.18
4 0.19
5 0.25
6 0.3
7 0.36
8 0.43
9 0.49
10 0.58
11 0.66
12 0.73
13 0.77
14 0.78
15 0.81
16 0.84
17 0.85
18 0.85
19 0.83
20 0.85
21 0.82
22 0.81
23 0.78
24 0.78
25 0.78
26 0.76
27 0.75
28 0.73
29 0.71
30 0.72
31 0.75
32 0.74
33 0.71
34 0.72
35 0.74
36 0.71
37 0.72
38 0.68
39 0.64
40 0.59
41 0.53
42 0.52
43 0.42
44 0.36
45 0.31
46 0.27
47 0.22
48 0.18
49 0.16
50 0.1
51 0.09
52 0.09
53 0.11
54 0.11
55 0.09
56 0.12
57 0.2
58 0.26
59 0.36
60 0.44
61 0.52
62 0.6
63 0.7
64 0.78
65 0.79
66 0.82
67 0.81
68 0.81
69 0.76
70 0.79
71 0.79
72 0.78
73 0.71
74 0.7
75 0.64
76 0.6
77 0.6
78 0.52
79 0.46
80 0.41
81 0.41
82 0.34
83 0.31
84 0.25
85 0.21
86 0.22
87 0.2
88 0.15
89 0.12
90 0.13
91 0.13
92 0.14
93 0.14
94 0.11
95 0.1
96 0.13
97 0.15
98 0.21
99 0.28
100 0.32
101 0.35
102 0.38
103 0.39
104 0.38
105 0.41
106 0.45
107 0.44
108 0.42
109 0.41
110 0.39
111 0.38
112 0.42
113 0.39
114 0.31
115 0.25
116 0.22
117 0.21
118 0.25
119 0.3
120 0.27
121 0.3
122 0.31
123 0.34
124 0.41
125 0.43
126 0.43
127 0.38
128 0.37
129 0.34
130 0.3
131 0.27
132 0.19
133 0.16
134 0.1
135 0.07
136 0.05
137 0.04
138 0.04
139 0.04
140 0.03
141 0.03
142 0.04
143 0.05
144 0.05
145 0.05
146 0.04
147 0.05
148 0.07
149 0.08
150 0.08
151 0.13
152 0.16
153 0.17
154 0.18
155 0.18
156 0.17
157 0.17
158 0.19
159 0.14
160 0.11
161 0.1
162 0.11
163 0.11
164 0.1
165 0.09
166 0.08
167 0.08
168 0.09
169 0.09
170 0.08
171 0.08
172 0.12
173 0.12
174 0.13
175 0.15
176 0.17
177 0.17
178 0.17
179 0.16
180 0.13
181 0.15
182 0.16
183 0.15
184 0.13
185 0.12
186 0.14
187 0.17
188 0.19
189 0.18
190 0.16
191 0.17
192 0.17
193 0.18
194 0.19
195 0.18
196 0.17
197 0.21
198 0.25
199 0.24
200 0.28
201 0.27
202 0.27