Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6HUX1

Protein Details
Accession B6HUX1    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
69-95CKCCCSCCCPSGRRRNKTPKHFDDFHQHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 8, nucl 7.5, cyto_nucl 5.5, mito 4, cyto 2.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR037504  PSI_induc_2  
Gene Ontology GO:0016020  C:membrane  
KEGG pcs:Pc22g09900  -  
Amino Acid Sequences MSPANITLWARGTASDLESVPDTFSSWDKCMAKSYCKWPVIVGIIVGSVVLLAVLACIINCLCCGYQCCKCCCSCCCPSGRRRNKTPKHFDDFHQPPPAPNPVYQPPPAPPSYRGAQQSAPSFRGAQQTAHFDAPKSPAHVNEDALPEMPTWAGAVDKHVEDPNHRDDVEMEPLNPPDRKQTGTPGVAYSDYSPNPTMGAAAAGYRGFGPTDPRARRSPGPGAALNPVQDPYGRRSPGTPSPGGAIDPYGRRSPGPAALGAAQDPYSRRSPGPAALAATQDPYGRRSPGMSPAPAAGYGAAAHDPYGPRSPGVTSPVGAPVHNPYDQQQYQGSYDDHSYGAGNGYHAVAAPSPVAAYKPHTNYSPVPMAFSPSSEIDHSAAAAPTPGFQRQPSFGSSQYPPTYTSQPPYRGFSPAPSSPPPAFSAASPSEYATYNPHANTIPIPEPDNTRPPSLLQSGKKPTVNASSNF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.17
4 0.18
5 0.19
6 0.19
7 0.17
8 0.15
9 0.14
10 0.13
11 0.16
12 0.19
13 0.19
14 0.26
15 0.27
16 0.28
17 0.36
18 0.39
19 0.44
20 0.47
21 0.54
22 0.56
23 0.56
24 0.56
25 0.48
26 0.49
27 0.45
28 0.39
29 0.3
30 0.2
31 0.18
32 0.17
33 0.15
34 0.09
35 0.05
36 0.04
37 0.03
38 0.02
39 0.02
40 0.02
41 0.02
42 0.03
43 0.03
44 0.04
45 0.04
46 0.04
47 0.05
48 0.07
49 0.08
50 0.1
51 0.14
52 0.2
53 0.27
54 0.34
55 0.38
56 0.4
57 0.42
58 0.46
59 0.47
60 0.49
61 0.49
62 0.48
63 0.53
64 0.57
65 0.65
66 0.7
67 0.76
68 0.78
69 0.82
70 0.87
71 0.89
72 0.91
73 0.92
74 0.9
75 0.88
76 0.82
77 0.75
78 0.74
79 0.7
80 0.66
81 0.63
82 0.53
83 0.46
84 0.47
85 0.51
86 0.42
87 0.38
88 0.37
89 0.35
90 0.39
91 0.39
92 0.38
93 0.34
94 0.37
95 0.38
96 0.35
97 0.32
98 0.31
99 0.33
100 0.36
101 0.35
102 0.33
103 0.34
104 0.35
105 0.4
106 0.39
107 0.38
108 0.33
109 0.31
110 0.31
111 0.34
112 0.31
113 0.26
114 0.25
115 0.29
116 0.31
117 0.33
118 0.3
119 0.24
120 0.26
121 0.27
122 0.26
123 0.24
124 0.23
125 0.22
126 0.27
127 0.28
128 0.26
129 0.26
130 0.26
131 0.23
132 0.22
133 0.2
134 0.15
135 0.13
136 0.12
137 0.08
138 0.06
139 0.05
140 0.05
141 0.05
142 0.07
143 0.08
144 0.09
145 0.11
146 0.13
147 0.14
148 0.16
149 0.21
150 0.23
151 0.24
152 0.24
153 0.22
154 0.21
155 0.24
156 0.28
157 0.23
158 0.19
159 0.18
160 0.19
161 0.22
162 0.21
163 0.18
164 0.19
165 0.2
166 0.22
167 0.22
168 0.28
169 0.32
170 0.33
171 0.34
172 0.28
173 0.27
174 0.25
175 0.24
176 0.19
177 0.16
178 0.14
179 0.15
180 0.15
181 0.13
182 0.13
183 0.13
184 0.11
185 0.07
186 0.07
187 0.05
188 0.04
189 0.05
190 0.05
191 0.05
192 0.05
193 0.05
194 0.05
195 0.05
196 0.09
197 0.12
198 0.22
199 0.24
200 0.27
201 0.3
202 0.34
203 0.36
204 0.38
205 0.39
206 0.34
207 0.36
208 0.34
209 0.32
210 0.31
211 0.29
212 0.24
213 0.19
214 0.15
215 0.11
216 0.11
217 0.11
218 0.14
219 0.19
220 0.19
221 0.19
222 0.2
223 0.25
224 0.3
225 0.33
226 0.29
227 0.23
228 0.24
229 0.24
230 0.23
231 0.18
232 0.12
233 0.1
234 0.11
235 0.13
236 0.12
237 0.12
238 0.12
239 0.14
240 0.15
241 0.16
242 0.16
243 0.14
244 0.14
245 0.15
246 0.15
247 0.14
248 0.12
249 0.09
250 0.08
251 0.09
252 0.11
253 0.12
254 0.13
255 0.13
256 0.16
257 0.17
258 0.19
259 0.22
260 0.2
261 0.19
262 0.19
263 0.2
264 0.17
265 0.16
266 0.14
267 0.12
268 0.11
269 0.12
270 0.13
271 0.13
272 0.13
273 0.15
274 0.16
275 0.23
276 0.27
277 0.24
278 0.23
279 0.23
280 0.23
281 0.21
282 0.19
283 0.11
284 0.07
285 0.06
286 0.06
287 0.06
288 0.05
289 0.05
290 0.07
291 0.08
292 0.1
293 0.13
294 0.13
295 0.13
296 0.14
297 0.15
298 0.16
299 0.2
300 0.18
301 0.15
302 0.16
303 0.21
304 0.21
305 0.19
306 0.18
307 0.17
308 0.2
309 0.2
310 0.2
311 0.17
312 0.25
313 0.26
314 0.27
315 0.25
316 0.24
317 0.25
318 0.27
319 0.25
320 0.18
321 0.19
322 0.17
323 0.15
324 0.13
325 0.12
326 0.1
327 0.11
328 0.1
329 0.09
330 0.08
331 0.08
332 0.08
333 0.08
334 0.08
335 0.06
336 0.06
337 0.06
338 0.05
339 0.05
340 0.06
341 0.07
342 0.07
343 0.12
344 0.19
345 0.23
346 0.25
347 0.27
348 0.31
349 0.32
350 0.37
351 0.4
352 0.33
353 0.32
354 0.29
355 0.33
356 0.29
357 0.27
358 0.24
359 0.18
360 0.2
361 0.17
362 0.19
363 0.15
364 0.15
365 0.15
366 0.13
367 0.12
368 0.1
369 0.11
370 0.09
371 0.1
372 0.13
373 0.15
374 0.15
375 0.17
376 0.21
377 0.23
378 0.25
379 0.27
380 0.27
381 0.26
382 0.3
383 0.31
384 0.35
385 0.34
386 0.33
387 0.32
388 0.33
389 0.37
390 0.35
391 0.41
392 0.41
393 0.46
394 0.48
395 0.52
396 0.49
397 0.49
398 0.46
399 0.45
400 0.44
401 0.4
402 0.43
403 0.41
404 0.45
405 0.41
406 0.42
407 0.39
408 0.35
409 0.31
410 0.26
411 0.29
412 0.26
413 0.28
414 0.26
415 0.24
416 0.22
417 0.22
418 0.23
419 0.2
420 0.23
421 0.25
422 0.24
423 0.26
424 0.25
425 0.26
426 0.27
427 0.28
428 0.27
429 0.25
430 0.28
431 0.27
432 0.33
433 0.38
434 0.44
435 0.41
436 0.4
437 0.39
438 0.38
439 0.43
440 0.43
441 0.46
442 0.43
443 0.5
444 0.56
445 0.62
446 0.62
447 0.57
448 0.56
449 0.57