Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6HIJ6

Protein Details
Accession B6HIJ6    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
86-111VSKGQTPVRRCKPGRRWEGRNQVTMRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 12.5, cyto 8.5
Family & Domain DBs
KEGG pcs:Pc21g10490  -  
Amino Acid Sequences MDIQTVGAVHTGDDLLPRVCSRARDAPGVDRSHIVHGEGSGGEGNPSYEPAYHDRFSEVHNFHQLRSSRVHPADPLIFPLMSLSGVSKGQTPVRRCKPGRRWEGRNQVTMRRALSYLEGYSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.11
4 0.11
5 0.13
6 0.15
7 0.17
8 0.22
9 0.29
10 0.31
11 0.35
12 0.37
13 0.42
14 0.47
15 0.47
16 0.42
17 0.35
18 0.33
19 0.31
20 0.29
21 0.22
22 0.16
23 0.13
24 0.13
25 0.11
26 0.1
27 0.08
28 0.07
29 0.06
30 0.06
31 0.07
32 0.05
33 0.06
34 0.06
35 0.06
36 0.09
37 0.13
38 0.18
39 0.17
40 0.18
41 0.18
42 0.19
43 0.2
44 0.25
45 0.23
46 0.2
47 0.27
48 0.27
49 0.26
50 0.31
51 0.31
52 0.25
53 0.27
54 0.28
55 0.27
56 0.28
57 0.29
58 0.23
59 0.25
60 0.26
61 0.23
62 0.22
63 0.16
64 0.15
65 0.14
66 0.14
67 0.11
68 0.08
69 0.08
70 0.06
71 0.06
72 0.07
73 0.08
74 0.09
75 0.12
76 0.17
77 0.24
78 0.28
79 0.37
80 0.46
81 0.56
82 0.58
83 0.67
84 0.71
85 0.75
86 0.81
87 0.81
88 0.8
89 0.8
90 0.88
91 0.83
92 0.81
93 0.75
94 0.72
95 0.67
96 0.63
97 0.54
98 0.45
99 0.4
100 0.33
101 0.32
102 0.28