Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6HN27

Protein Details
Accession B6HN27    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
46-67VESLRGKKYHILRKQRRTGAKAHydrophilic
155-175DYVHRVCAARKLRYRRTERPHBasic
NLS Segment(s)
PositionSequence
51-79GKKYHILRKQRRTGAKAPGRSGKQKRPGD
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
KEGG pcs:Pc21g00160  -  
Amino Acid Sequences MSPRSACGWPEWEEKNLLSWLDAHRDLSWKALSDAYYEEYQVDRSVESLRGKKYHILRKQRRTGAKAPGRSGKQKRPGDMRRSLVDSGSRSPLPDNNSAQRNIDKWFQTILAADPSQSGDSDKPAQTARSKIRCVTPAPLPYSPRRTRSSSWMWDYVHRVCAARKLRYRRTERPH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.33
3 0.3
4 0.26
5 0.2
6 0.2
7 0.2
8 0.23
9 0.24
10 0.22
11 0.21
12 0.25
13 0.25
14 0.26
15 0.24
16 0.2
17 0.2
18 0.2
19 0.19
20 0.17
21 0.19
22 0.18
23 0.17
24 0.16
25 0.15
26 0.13
27 0.14
28 0.13
29 0.12
30 0.09
31 0.09
32 0.11
33 0.15
34 0.2
35 0.24
36 0.27
37 0.28
38 0.3
39 0.35
40 0.42
41 0.47
42 0.51
43 0.57
44 0.64
45 0.72
46 0.8
47 0.82
48 0.81
49 0.78
50 0.75
51 0.75
52 0.72
53 0.67
54 0.61
55 0.6
56 0.57
57 0.6
58 0.6
59 0.58
60 0.61
61 0.6
62 0.6
63 0.63
64 0.68
65 0.66
66 0.66
67 0.61
68 0.53
69 0.53
70 0.48
71 0.38
72 0.33
73 0.27
74 0.22
75 0.21
76 0.18
77 0.15
78 0.16
79 0.18
80 0.19
81 0.22
82 0.23
83 0.25
84 0.28
85 0.29
86 0.3
87 0.29
88 0.26
89 0.23
90 0.25
91 0.21
92 0.19
93 0.19
94 0.18
95 0.17
96 0.16
97 0.15
98 0.13
99 0.12
100 0.11
101 0.1
102 0.11
103 0.11
104 0.1
105 0.11
106 0.08
107 0.12
108 0.17
109 0.17
110 0.18
111 0.19
112 0.22
113 0.24
114 0.31
115 0.37
116 0.4
117 0.42
118 0.43
119 0.48
120 0.48
121 0.48
122 0.45
123 0.43
124 0.42
125 0.45
126 0.46
127 0.45
128 0.48
129 0.55
130 0.57
131 0.56
132 0.54
133 0.55
134 0.54
135 0.59
136 0.61
137 0.6
138 0.6
139 0.6
140 0.57
141 0.56
142 0.58
143 0.52
144 0.47
145 0.39
146 0.35
147 0.31
148 0.38
149 0.41
150 0.45
151 0.51
152 0.57
153 0.65
154 0.74
155 0.81