Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6GX52

Protein Details
Accession B6GX52   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
20-41QIEKNLKKEWKKQDSEEQPQTNHydrophilic
NLS Segment(s)
PositionSequence
102-167AKTAAAKPAVKPTTTKAVPKAAAKPAAVKAAAKTAAAKPATPKAAPKKATAPKAATAKATPAKRKR
Subcellular Location(s) nucl 15.5, cyto_nucl 10, mito 6, cyto 3.5
Family & Domain DBs
KEGG pcs:Pc12g11310  -  
Amino Acid Sequences MRLLKAVQDGSLTVPKESLQIEKNLKKEWKKQDSEEQPQTNTKTTTTKTVTTKTVTVSKTVASKSTESKTTASKTAAKPAATKAAASKKDTASNVAPKATAAKTAAAKPAVKPTTTKAVPKAAAKPAAVKAAAKTAAAKPATPKAAPKKATAPKAATAKATPAKRKRTSNDEETLNKLQTAKRRVYAKKAQRDTDVPTNSHPEPSGWSEQPEYEDAPPSYEFACRMVDIFPLIYRRKLCHSNLPDQDGEHPYDALDDQMDIDYDGESSDPPSPPRTLKNTLGLLNGTYKVRSSDIENGWPDAMPYEGITLSLRLNGNEMWGAYEFGALRVYCGFRNDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.21
4 0.22
5 0.23
6 0.21
7 0.29
8 0.38
9 0.44
10 0.48
11 0.53
12 0.6
13 0.63
14 0.69
15 0.72
16 0.73
17 0.74
18 0.76
19 0.79
20 0.81
21 0.83
22 0.82
23 0.76
24 0.7
25 0.69
26 0.66
27 0.6
28 0.51
29 0.43
30 0.4
31 0.37
32 0.42
33 0.4
34 0.43
35 0.44
36 0.47
37 0.49
38 0.46
39 0.46
40 0.41
41 0.44
42 0.38
43 0.35
44 0.32
45 0.29
46 0.31
47 0.3
48 0.29
49 0.25
50 0.27
51 0.3
52 0.33
53 0.35
54 0.32
55 0.33
56 0.35
57 0.36
58 0.37
59 0.35
60 0.39
61 0.37
62 0.44
63 0.46
64 0.41
65 0.4
66 0.39
67 0.44
68 0.36
69 0.35
70 0.32
71 0.37
72 0.4
73 0.4
74 0.42
75 0.37
76 0.42
77 0.42
78 0.4
79 0.37
80 0.4
81 0.39
82 0.35
83 0.32
84 0.26
85 0.3
86 0.25
87 0.22
88 0.16
89 0.17
90 0.19
91 0.22
92 0.25
93 0.24
94 0.25
95 0.23
96 0.32
97 0.3
98 0.28
99 0.27
100 0.26
101 0.33
102 0.34
103 0.36
104 0.31
105 0.35
106 0.37
107 0.4
108 0.42
109 0.38
110 0.39
111 0.36
112 0.36
113 0.31
114 0.31
115 0.28
116 0.23
117 0.18
118 0.19
119 0.19
120 0.15
121 0.16
122 0.14
123 0.2
124 0.2
125 0.19
126 0.18
127 0.22
128 0.25
129 0.23
130 0.28
131 0.3
132 0.38
133 0.4
134 0.4
135 0.44
136 0.48
137 0.53
138 0.51
139 0.45
140 0.42
141 0.45
142 0.44
143 0.35
144 0.29
145 0.29
146 0.3
147 0.32
148 0.36
149 0.39
150 0.47
151 0.52
152 0.58
153 0.57
154 0.61
155 0.63
156 0.61
157 0.58
158 0.54
159 0.49
160 0.48
161 0.46
162 0.37
163 0.31
164 0.26
165 0.24
166 0.25
167 0.29
168 0.26
169 0.29
170 0.37
171 0.39
172 0.46
173 0.53
174 0.56
175 0.61
176 0.64
177 0.62
178 0.57
179 0.57
180 0.54
181 0.53
182 0.47
183 0.38
184 0.34
185 0.36
186 0.33
187 0.31
188 0.26
189 0.17
190 0.17
191 0.21
192 0.24
193 0.19
194 0.21
195 0.2
196 0.21
197 0.22
198 0.2
199 0.18
200 0.14
201 0.17
202 0.15
203 0.16
204 0.16
205 0.15
206 0.14
207 0.13
208 0.13
209 0.11
210 0.12
211 0.1
212 0.11
213 0.1
214 0.1
215 0.1
216 0.1
217 0.1
218 0.15
219 0.16
220 0.19
221 0.2
222 0.22
223 0.28
224 0.34
225 0.36
226 0.41
227 0.45
228 0.51
229 0.54
230 0.56
231 0.51
232 0.45
233 0.47
234 0.39
235 0.35
236 0.26
237 0.21
238 0.16
239 0.16
240 0.16
241 0.11
242 0.09
243 0.06
244 0.06
245 0.06
246 0.07
247 0.06
248 0.06
249 0.06
250 0.05
251 0.05
252 0.05
253 0.05
254 0.07
255 0.1
256 0.11
257 0.13
258 0.17
259 0.2
260 0.23
261 0.3
262 0.36
263 0.39
264 0.43
265 0.48
266 0.49
267 0.48
268 0.47
269 0.41
270 0.35
271 0.31
272 0.29
273 0.23
274 0.19
275 0.17
276 0.17
277 0.18
278 0.18
279 0.2
280 0.26
281 0.29
282 0.36
283 0.37
284 0.37
285 0.36
286 0.34
287 0.29
288 0.21
289 0.18
290 0.11
291 0.09
292 0.09
293 0.08
294 0.09
295 0.1
296 0.11
297 0.1
298 0.15
299 0.16
300 0.14
301 0.17
302 0.16
303 0.17
304 0.17
305 0.17
306 0.14
307 0.14
308 0.15
309 0.13
310 0.15
311 0.13
312 0.13
313 0.16
314 0.13
315 0.14
316 0.16
317 0.18
318 0.18