Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6GYK3

Protein Details
Accession B6GYK3   
Localization Confidence Low
Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
4-24HFFNKLFKPKGKGPKEPRFTLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 7.5, cyto_nucl 6.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036156  Beta-gal/glucu_dom_sf  
IPR041625  Beta-mannosidase_Ig  
IPR013783  Ig-like_fold  
Gene Ontology GO:0004567  F:beta-mannosidase activity  
KEGG pcs:Pc12g08740  -  
Pfam View protein in Pfam  
PF17753  Ig_mannosidase  
Amino Acid Sequences MAPHFFNKLFKPKGKGPKEPRFTLQECSPNAIGIWDSTCEINGDIFNRWKLPIQPEQRPRSPGARQKSSQQQSPFFRLPAEIRRPVYLELIGRSASAYSVLLEKAIAGTTQQASLALVACYPELKLSRDAQAGTFTVKAQSAVPLYTWLDYTAGVVGYFEDNSFPLLPDEKRTLRFVVQKDETRGSGITVRSLWDQTTKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.77
3 0.78
4 0.8
5 0.82
6 0.8
7 0.76
8 0.73
9 0.67
10 0.63
11 0.59
12 0.56
13 0.49
14 0.5
15 0.45
16 0.36
17 0.34
18 0.28
19 0.21
20 0.14
21 0.14
22 0.09
23 0.1
24 0.1
25 0.1
26 0.1
27 0.1
28 0.1
29 0.1
30 0.1
31 0.13
32 0.16
33 0.17
34 0.18
35 0.18
36 0.2
37 0.23
38 0.27
39 0.33
40 0.38
41 0.46
42 0.54
43 0.6
44 0.62
45 0.62
46 0.59
47 0.57
48 0.58
49 0.56
50 0.56
51 0.57
52 0.54
53 0.57
54 0.64
55 0.62
56 0.6
57 0.57
58 0.55
59 0.52
60 0.57
61 0.52
62 0.42
63 0.37
64 0.33
65 0.31
66 0.32
67 0.34
68 0.32
69 0.31
70 0.32
71 0.33
72 0.32
73 0.3
74 0.23
75 0.18
76 0.14
77 0.14
78 0.13
79 0.11
80 0.1
81 0.09
82 0.07
83 0.06
84 0.05
85 0.04
86 0.05
87 0.05
88 0.05
89 0.05
90 0.05
91 0.04
92 0.04
93 0.04
94 0.03
95 0.05
96 0.05
97 0.05
98 0.06
99 0.05
100 0.05
101 0.06
102 0.06
103 0.05
104 0.05
105 0.05
106 0.05
107 0.05
108 0.05
109 0.07
110 0.07
111 0.1
112 0.13
113 0.14
114 0.18
115 0.19
116 0.2
117 0.18
118 0.19
119 0.18
120 0.16
121 0.15
122 0.12
123 0.11
124 0.11
125 0.11
126 0.09
127 0.11
128 0.11
129 0.11
130 0.11
131 0.12
132 0.12
133 0.12
134 0.12
135 0.1
136 0.1
137 0.09
138 0.1
139 0.08
140 0.07
141 0.07
142 0.06
143 0.06
144 0.07
145 0.07
146 0.07
147 0.06
148 0.06
149 0.09
150 0.09
151 0.09
152 0.1
153 0.13
154 0.14
155 0.19
156 0.25
157 0.28
158 0.31
159 0.33
160 0.35
161 0.37
162 0.44
163 0.43
164 0.47
165 0.5
166 0.53
167 0.56
168 0.56
169 0.51
170 0.46
171 0.42
172 0.34
173 0.32
174 0.26
175 0.24
176 0.21
177 0.22
178 0.23
179 0.24
180 0.23