Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6GYY7

Protein Details
Accession B6GYY7   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
13-41LWKTPWRLSSPQKARQRKRLRSVDRVVDTHydrophilic
78-106FDKKEKSYRKSIHKLPKWTRVSQRVNPPGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG pcs:Pc12g12640  -  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFKSTQALFGGLLWKTPWRLSSPQKARQRKRLRSVDRVVDTVSAALERNGQTSKAVSRWFAEMPREEEMLPKDKYTLFDKKEKSYRKSIHKLPKWTRVSQRVNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.18
4 0.19
5 0.2
6 0.28
7 0.35
8 0.45
9 0.52
10 0.6
11 0.68
12 0.77
13 0.8
14 0.84
15 0.87
16 0.86
17 0.87
18 0.88
19 0.86
20 0.84
21 0.83
22 0.81
23 0.72
24 0.63
25 0.54
26 0.43
27 0.35
28 0.25
29 0.18
30 0.1
31 0.07
32 0.06
33 0.08
34 0.08
35 0.09
36 0.09
37 0.1
38 0.1
39 0.11
40 0.12
41 0.12
42 0.13
43 0.12
44 0.12
45 0.15
46 0.15
47 0.16
48 0.18
49 0.18
50 0.2
51 0.22
52 0.21
53 0.19
54 0.21
55 0.21
56 0.24
57 0.22
58 0.2
59 0.19
60 0.19
61 0.22
62 0.26
63 0.32
64 0.3
65 0.38
66 0.42
67 0.49
68 0.57
69 0.63
70 0.62
71 0.64
72 0.68
73 0.7
74 0.76
75 0.77
76 0.8
77 0.79
78 0.85
79 0.83
80 0.85
81 0.81
82 0.8
83 0.8
84 0.8
85 0.8
86 0.78
87 0.8