Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6HDI1

Protein Details
Accession B6HDI1   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
67-90PITRSSTSSRGKRQRRRPSATYVDHydrophilic
94-115KPTTVRSSRRYRDHDDLRRPAKBasic
NLS Segment(s)
PositionSequence
78-82KRQRR
Subcellular Location(s) extr 9, plas 5, nucl 4, cyto 4, cyto_nucl 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG pcs:Pc20g04330  -  
Amino Acid Sequences MAPINSMLEPRQSSGDTCPSTISGGGIAGIVIGSIAGTLLILWLWRIFRLPGAWSGGDTSDVGYRPPITRSSTSSRGKRQRRRPSATYVDYVEKPTTVRSSRRYRDHDDLRRPAKVYLSEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.33
3 0.29
4 0.28
5 0.27
6 0.25
7 0.25
8 0.23
9 0.19
10 0.1
11 0.09
12 0.08
13 0.07
14 0.06
15 0.04
16 0.04
17 0.03
18 0.02
19 0.02
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.03
30 0.04
31 0.04
32 0.05
33 0.06
34 0.06
35 0.07
36 0.08
37 0.09
38 0.11
39 0.13
40 0.13
41 0.12
42 0.12
43 0.11
44 0.11
45 0.1
46 0.08
47 0.07
48 0.07
49 0.07
50 0.07
51 0.08
52 0.09
53 0.1
54 0.12
55 0.15
56 0.17
57 0.22
58 0.28
59 0.35
60 0.42
61 0.47
62 0.54
63 0.61
64 0.69
65 0.74
66 0.79
67 0.81
68 0.85
69 0.86
70 0.81
71 0.81
72 0.79
73 0.74
74 0.66
75 0.58
76 0.52
77 0.45
78 0.43
79 0.34
80 0.25
81 0.22
82 0.21
83 0.24
84 0.25
85 0.3
86 0.35
87 0.46
88 0.54
89 0.63
90 0.67
91 0.69
92 0.75
93 0.79
94 0.81
95 0.81
96 0.82
97 0.78
98 0.76
99 0.7
100 0.62
101 0.57