Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5QMU7

Protein Details
Accession A0A5N5QMU7   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
214-238PCTPCPNSPKTQKSQKRARSTTPETHydrophilic
260-282APVAPVKKRRIVKKEEDIKPKLEBasic
NLS Segment(s)
PositionSequence
266-273KKRRIVKK
Subcellular Location(s) nucl 13, cyto_nucl 11.5, cyto 8, mito 4
Family & Domain DBs
Amino Acid Sequences MINKRLGISAWITDSRDKLLPEYQVEYIDDETMECWIPSTEGTNFEIKWTLLGEPQPGLDLGIRPFLDGIGMNGTAQLTSHLVEKPVGRLYQQRTGASSARLYQFGKRVLTDKDDGINLTGATLNELNTIRVELQWGHCGIAVPATAFTNPKDIGPIHEKAAKKGHAGSAELGKSVVVPKTCGAVFTPEPSMRRRSFIFHYGSEDWLRAREIIPCTPCPNSPKTQKSQKRARSTTPETIDIDELETDDEDIVIIKHMIPAPVAPVKKRRIVKKEEDIKPKLETVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.3
4 0.28
5 0.26
6 0.28
7 0.31
8 0.31
9 0.33
10 0.31
11 0.29
12 0.29
13 0.28
14 0.24
15 0.2
16 0.16
17 0.13
18 0.11
19 0.11
20 0.11
21 0.08
22 0.08
23 0.08
24 0.08
25 0.08
26 0.12
27 0.12
28 0.15
29 0.17
30 0.2
31 0.19
32 0.2
33 0.22
34 0.18
35 0.17
36 0.15
37 0.14
38 0.14
39 0.16
40 0.16
41 0.15
42 0.15
43 0.15
44 0.13
45 0.13
46 0.11
47 0.11
48 0.1
49 0.15
50 0.15
51 0.14
52 0.14
53 0.13
54 0.13
55 0.1
56 0.11
57 0.08
58 0.08
59 0.08
60 0.08
61 0.09
62 0.07
63 0.07
64 0.07
65 0.06
66 0.06
67 0.09
68 0.09
69 0.1
70 0.12
71 0.13
72 0.15
73 0.18
74 0.18
75 0.17
76 0.23
77 0.27
78 0.33
79 0.37
80 0.34
81 0.33
82 0.36
83 0.36
84 0.31
85 0.27
86 0.23
87 0.21
88 0.22
89 0.22
90 0.21
91 0.24
92 0.26
93 0.26
94 0.23
95 0.25
96 0.24
97 0.27
98 0.26
99 0.22
100 0.2
101 0.19
102 0.18
103 0.16
104 0.14
105 0.1
106 0.09
107 0.09
108 0.07
109 0.08
110 0.08
111 0.07
112 0.09
113 0.09
114 0.09
115 0.08
116 0.09
117 0.08
118 0.07
119 0.08
120 0.07
121 0.08
122 0.1
123 0.1
124 0.1
125 0.1
126 0.11
127 0.09
128 0.09
129 0.08
130 0.06
131 0.06
132 0.06
133 0.06
134 0.06
135 0.07
136 0.09
137 0.09
138 0.09
139 0.11
140 0.11
141 0.14
142 0.18
143 0.19
144 0.18
145 0.23
146 0.23
147 0.24
148 0.3
149 0.28
150 0.24
151 0.25
152 0.26
153 0.23
154 0.24
155 0.22
156 0.21
157 0.2
158 0.18
159 0.16
160 0.13
161 0.12
162 0.12
163 0.13
164 0.09
165 0.1
166 0.1
167 0.13
168 0.13
169 0.13
170 0.12
171 0.14
172 0.15
173 0.16
174 0.2
175 0.2
176 0.22
177 0.24
178 0.31
179 0.27
180 0.29
181 0.29
182 0.29
183 0.32
184 0.37
185 0.38
186 0.33
187 0.38
188 0.36
189 0.38
190 0.34
191 0.3
192 0.23
193 0.2
194 0.19
195 0.14
196 0.13
197 0.16
198 0.18
199 0.23
200 0.27
201 0.28
202 0.31
203 0.32
204 0.35
205 0.34
206 0.36
207 0.39
208 0.45
209 0.5
210 0.56
211 0.65
212 0.71
213 0.76
214 0.81
215 0.83
216 0.84
217 0.82
218 0.82
219 0.81
220 0.8
221 0.79
222 0.73
223 0.67
224 0.58
225 0.54
226 0.46
227 0.36
228 0.3
229 0.2
230 0.16
231 0.12
232 0.11
233 0.09
234 0.08
235 0.07
236 0.06
237 0.06
238 0.06
239 0.06
240 0.06
241 0.06
242 0.1
243 0.12
244 0.12
245 0.12
246 0.13
247 0.17
248 0.23
249 0.26
250 0.28
251 0.35
252 0.41
253 0.48
254 0.56
255 0.61
256 0.64
257 0.71
258 0.76
259 0.78
260 0.83
261 0.84
262 0.87
263 0.81
264 0.75
265 0.69