Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5QNV2

Protein Details
Accession A0A5N5QNV2    Localization Confidence High Confidence Score 17.4
NoLS Segment(s)
PositionSequenceProtein Nature
411-490GYRDERRDRDRDRDRDRDRREKDRERDRDRDRRDRDRDYDSERTRERDRDRRRDYDSDRDRRYDSDRERRRDKDRDGRRRBasic
NLS Segment(s)
PositionSequence
136-145AGKSREKPKG
378-447RGGSGSGMSSRRTSRSRSGSPPRGGRRDSERREGYRDERRDRDRDRDRDRDRREKDRERDRDRDRRDRDR
453-463RTRERDRDRRR
475-490SDRERRRDKDRDGRRR
Subcellular Location(s) nucl 14, mito 9, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR045166  Spp2-like  
IPR026822  Spp2/MOS2_G-patch  
Gene Ontology GO:0005634  C:nucleus  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF12656  G-patch_2  
Amino Acid Sequences MGGCTATGLHRGLQSSTMASKVSFIVRPPPRTFETETPEPSRPGTASPDSDTPRLPHQPATSSPLASAPRSGSETRTGAGKRQWESYTAPDSSDEEEQDTKEMITGFDAMGVQRWVDPCAKWTDCVKAHSQTGPRAGKSREKPKGPLVIPAQKNRDWRAESMARRRQAMHGYVPDGAKVATGKDGSQGGLGTRGKINDGPQLSGLVVTKREEVKVEEVDVEMDEVKEEVQEEVKEEEMDEDQRALRALLSGTSGEEKKVEIAAIQVQEQSGAWQQPKSEADAFKEDVANRPDEATLADYERVPIELFGEAMLRGMGHIPGKAASRTGAGRIEPYIPESRPALLGIGAKPRPVDEQDAKNGKKYLKPDKRYIPVVKVERGGSGSGMSSRRTSRSRSGSPPRGGRRDSERREGYRDERRDRDRDRDRDRDRREKDRERDRDRDRRDRDRDYDSERTRERDRDRRRDYDSDRDRRYDSDRERRRDKDRDGRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.21
4 0.21
5 0.19
6 0.17
7 0.17
8 0.18
9 0.21
10 0.2
11 0.2
12 0.28
13 0.36
14 0.44
15 0.46
16 0.5
17 0.49
18 0.53
19 0.58
20 0.56
21 0.56
22 0.56
23 0.59
24 0.58
25 0.58
26 0.53
27 0.48
28 0.43
29 0.35
30 0.3
31 0.31
32 0.3
33 0.31
34 0.33
35 0.39
36 0.4
37 0.41
38 0.41
39 0.36
40 0.39
41 0.42
42 0.4
43 0.39
44 0.39
45 0.42
46 0.43
47 0.47
48 0.42
49 0.36
50 0.34
51 0.34
52 0.33
53 0.28
54 0.28
55 0.22
56 0.22
57 0.26
58 0.26
59 0.24
60 0.27
61 0.28
62 0.26
63 0.31
64 0.29
65 0.3
66 0.34
67 0.38
68 0.35
69 0.39
70 0.4
71 0.36
72 0.39
73 0.4
74 0.41
75 0.34
76 0.32
77 0.28
78 0.29
79 0.28
80 0.27
81 0.21
82 0.18
83 0.19
84 0.19
85 0.19
86 0.17
87 0.14
88 0.14
89 0.13
90 0.1
91 0.1
92 0.1
93 0.09
94 0.09
95 0.1
96 0.08
97 0.09
98 0.09
99 0.09
100 0.1
101 0.11
102 0.12
103 0.14
104 0.14
105 0.16
106 0.23
107 0.24
108 0.24
109 0.26
110 0.32
111 0.33
112 0.36
113 0.38
114 0.35
115 0.37
116 0.4
117 0.42
118 0.38
119 0.44
120 0.45
121 0.42
122 0.43
123 0.44
124 0.48
125 0.52
126 0.58
127 0.58
128 0.58
129 0.61
130 0.62
131 0.68
132 0.59
133 0.58
134 0.55
135 0.56
136 0.56
137 0.59
138 0.57
139 0.52
140 0.57
141 0.52
142 0.52
143 0.45
144 0.42
145 0.43
146 0.45
147 0.49
148 0.54
149 0.58
150 0.52
151 0.52
152 0.52
153 0.48
154 0.45
155 0.42
156 0.37
157 0.32
158 0.32
159 0.33
160 0.31
161 0.27
162 0.22
163 0.18
164 0.13
165 0.1
166 0.09
167 0.08
168 0.08
169 0.08
170 0.1
171 0.11
172 0.11
173 0.11
174 0.11
175 0.08
176 0.14
177 0.14
178 0.13
179 0.14
180 0.14
181 0.15
182 0.16
183 0.17
184 0.17
185 0.18
186 0.17
187 0.16
188 0.16
189 0.15
190 0.14
191 0.14
192 0.09
193 0.09
194 0.1
195 0.12
196 0.13
197 0.13
198 0.13
199 0.15
200 0.17
201 0.17
202 0.17
203 0.14
204 0.13
205 0.13
206 0.12
207 0.1
208 0.07
209 0.05
210 0.05
211 0.04
212 0.04
213 0.04
214 0.04
215 0.04
216 0.05
217 0.06
218 0.07
219 0.08
220 0.08
221 0.08
222 0.08
223 0.08
224 0.08
225 0.09
226 0.07
227 0.07
228 0.07
229 0.07
230 0.08
231 0.07
232 0.06
233 0.06
234 0.05
235 0.05
236 0.06
237 0.06
238 0.06
239 0.08
240 0.08
241 0.08
242 0.08
243 0.08
244 0.08
245 0.08
246 0.07
247 0.05
248 0.06
249 0.09
250 0.09
251 0.09
252 0.09
253 0.09
254 0.09
255 0.09
256 0.09
257 0.08
258 0.1
259 0.1
260 0.11
261 0.11
262 0.15
263 0.16
264 0.19
265 0.21
266 0.2
267 0.22
268 0.25
269 0.26
270 0.22
271 0.24
272 0.21
273 0.22
274 0.22
275 0.21
276 0.17
277 0.17
278 0.16
279 0.14
280 0.14
281 0.1
282 0.09
283 0.1
284 0.1
285 0.09
286 0.1
287 0.1
288 0.1
289 0.08
290 0.07
291 0.06
292 0.06
293 0.06
294 0.06
295 0.06
296 0.05
297 0.05
298 0.05
299 0.04
300 0.04
301 0.05
302 0.06
303 0.06
304 0.06
305 0.07
306 0.09
307 0.11
308 0.11
309 0.11
310 0.1
311 0.12
312 0.12
313 0.14
314 0.15
315 0.13
316 0.14
317 0.15
318 0.17
319 0.15
320 0.18
321 0.19
322 0.18
323 0.19
324 0.19
325 0.18
326 0.17
327 0.17
328 0.14
329 0.11
330 0.14
331 0.14
332 0.21
333 0.2
334 0.2
335 0.2
336 0.21
337 0.22
338 0.22
339 0.27
340 0.26
341 0.31
342 0.4
343 0.49
344 0.48
345 0.49
346 0.51
347 0.46
348 0.45
349 0.47
350 0.49
351 0.51
352 0.57
353 0.62
354 0.67
355 0.71
356 0.75
357 0.73
358 0.68
359 0.66
360 0.65
361 0.6
362 0.54
363 0.48
364 0.41
365 0.37
366 0.3
367 0.22
368 0.17
369 0.14
370 0.15
371 0.16
372 0.16
373 0.18
374 0.2
375 0.26
376 0.28
377 0.33
378 0.38
379 0.46
380 0.51
381 0.58
382 0.66
383 0.7
384 0.75
385 0.78
386 0.78
387 0.77
388 0.72
389 0.67
390 0.67
391 0.68
392 0.67
393 0.67
394 0.67
395 0.63
396 0.67
397 0.68
398 0.66
399 0.66
400 0.69
401 0.67
402 0.68
403 0.71
404 0.74
405 0.74
406 0.76
407 0.76
408 0.77
409 0.78
410 0.8
411 0.82
412 0.83
413 0.87
414 0.87
415 0.84
416 0.84
417 0.86
418 0.85
419 0.86
420 0.87
421 0.88
422 0.86
423 0.89
424 0.88
425 0.88
426 0.87
427 0.88
428 0.86
429 0.86
430 0.86
431 0.85
432 0.81
433 0.79
434 0.76
435 0.73
436 0.74
437 0.69
438 0.69
439 0.64
440 0.63
441 0.62
442 0.64
443 0.66
444 0.66
445 0.71
446 0.74
447 0.78
448 0.81
449 0.82
450 0.83
451 0.81
452 0.81
453 0.81
454 0.8
455 0.78
456 0.74
457 0.69
458 0.63
459 0.63
460 0.62
461 0.62
462 0.62
463 0.66
464 0.71
465 0.78
466 0.81
467 0.84
468 0.84
469 0.84
470 0.84