Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q75DA3

Protein Details
Accession Q75DA3   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
92-117DQLKQERLRRLKKLKASKKSNHKTGVHydrophilic
NLS Segment(s)
PositionSequence
98-112RLRRLKKLKASKKSN
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039119  ABT1/Esf2  
IPR034353  ABT1/ESF2_RRM  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
Gene Ontology GO:0005730  C:nucleolus  
GO:0032040  C:small-subunit processome  
GO:0001671  F:ATPase activator activity  
GO:0003723  F:RNA binding  
GO:0000480  P:endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000447  P:endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000472  P:endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0034462  P:small-subunit processome assembly  
KEGG ago:AGOS_ABR121C  -  
CDD cd12263  RRM_ABT1_like  
Amino Acid Sequences MSDNDSDVQDFSSEEEDHGLLIDRKKQQTLDFAQDGSDSEGGSDLDDDDIAEEESPIQNETKAATGEEPATADGDNIAPQSADELRPEERADQLKQERLRRLKKLKASKKSNHKTGVVYLSKIPPYMKPAKMRQILSRFGDLDRLFLKREDEHSHRQRVKGGGNKKVMFREGWAEFIRKKDAKLCAETLNGNIIGGKKGNFYHDDVMNVKYLSGFKWADLTEQIARENDVRQSKLQLEISQANKLNAEFIRNVEKSKMLNNIRAKKHKDEDSSERTESHLPVKQRKVTSNRASAPESQKQPASEKLSNVLHNLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.14
4 0.13
5 0.14
6 0.15
7 0.16
8 0.19
9 0.26
10 0.31
11 0.35
12 0.38
13 0.41
14 0.41
15 0.46
16 0.49
17 0.5
18 0.44
19 0.41
20 0.38
21 0.36
22 0.33
23 0.27
24 0.21
25 0.12
26 0.1
27 0.11
28 0.1
29 0.1
30 0.09
31 0.07
32 0.06
33 0.06
34 0.06
35 0.06
36 0.07
37 0.07
38 0.06
39 0.06
40 0.07
41 0.08
42 0.09
43 0.09
44 0.09
45 0.09
46 0.1
47 0.11
48 0.12
49 0.11
50 0.12
51 0.11
52 0.13
53 0.13
54 0.13
55 0.13
56 0.1
57 0.11
58 0.1
59 0.09
60 0.08
61 0.07
62 0.07
63 0.07
64 0.07
65 0.06
66 0.05
67 0.08
68 0.09
69 0.1
70 0.1
71 0.13
72 0.14
73 0.16
74 0.17
75 0.16
76 0.19
77 0.22
78 0.23
79 0.29
80 0.32
81 0.37
82 0.42
83 0.48
84 0.52
85 0.57
86 0.64
87 0.65
88 0.7
89 0.71
90 0.74
91 0.79
92 0.8
93 0.81
94 0.83
95 0.82
96 0.85
97 0.86
98 0.85
99 0.79
100 0.72
101 0.64
102 0.58
103 0.58
104 0.48
105 0.4
106 0.34
107 0.32
108 0.29
109 0.28
110 0.24
111 0.17
112 0.22
113 0.28
114 0.31
115 0.34
116 0.4
117 0.48
118 0.53
119 0.54
120 0.54
121 0.52
122 0.53
123 0.48
124 0.45
125 0.36
126 0.31
127 0.34
128 0.27
129 0.23
130 0.19
131 0.18
132 0.16
133 0.16
134 0.18
135 0.13
136 0.17
137 0.21
138 0.26
139 0.34
140 0.4
141 0.49
142 0.5
143 0.49
144 0.49
145 0.47
146 0.46
147 0.44
148 0.44
149 0.43
150 0.47
151 0.48
152 0.47
153 0.45
154 0.4
155 0.33
156 0.28
157 0.25
158 0.19
159 0.2
160 0.19
161 0.2
162 0.2
163 0.22
164 0.27
165 0.23
166 0.23
167 0.25
168 0.31
169 0.33
170 0.35
171 0.35
172 0.31
173 0.32
174 0.32
175 0.27
176 0.22
177 0.18
178 0.14
179 0.13
180 0.11
181 0.1
182 0.1
183 0.1
184 0.09
185 0.1
186 0.13
187 0.15
188 0.17
189 0.2
190 0.2
191 0.23
192 0.22
193 0.23
194 0.21
195 0.19
196 0.16
197 0.13
198 0.13
199 0.11
200 0.15
201 0.14
202 0.12
203 0.16
204 0.16
205 0.16
206 0.16
207 0.19
208 0.16
209 0.17
210 0.18
211 0.15
212 0.16
213 0.16
214 0.18
215 0.2
216 0.22
217 0.23
218 0.23
219 0.27
220 0.27
221 0.31
222 0.32
223 0.27
224 0.28
225 0.32
226 0.33
227 0.36
228 0.36
229 0.31
230 0.3
231 0.28
232 0.28
233 0.22
234 0.23
235 0.18
236 0.18
237 0.26
238 0.26
239 0.28
240 0.25
241 0.28
242 0.26
243 0.29
244 0.37
245 0.32
246 0.4
247 0.48
248 0.56
249 0.62
250 0.7
251 0.71
252 0.71
253 0.75
254 0.75
255 0.72
256 0.71
257 0.71
258 0.7
259 0.7
260 0.63
261 0.55
262 0.49
263 0.45
264 0.4
265 0.37
266 0.34
267 0.35
268 0.43
269 0.51
270 0.56
271 0.59
272 0.65
273 0.67
274 0.72
275 0.74
276 0.74
277 0.72
278 0.69
279 0.67
280 0.66
281 0.66
282 0.65
283 0.61
284 0.56
285 0.53
286 0.51
287 0.52
288 0.52
289 0.52
290 0.48
291 0.45
292 0.48
293 0.5
294 0.49