Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A5N5QLL2

Protein Details
Accession A0A5N5QLL2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
27-52SITGYNYLQKKRRREQLKREVRDALAHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 10, plas 5, cyto 4, E.R. 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR045886  ThiF/MoeB/HesA  
IPR000594  ThiF_NAD_FAD-bd  
IPR035985  Ubiquitin-activating_enz  
Gene Ontology GO:0016020  C:membrane  
GO:0008641  F:ubiquitin-like modifier activating enzyme activity  
Pfam View protein in Pfam  
PF00899  ThiF  
Amino Acid Sequences MAPVFLKSENARMATVAATASALTILSITGYNYLQKKRRREQLKREVRDALAATPPEPELNIRQFGIGQPAFDNFHSGMTSRNFDESIIREMLARNYAFLGEEAMGKVRGGRVVVVGCGGVGSWAAVMLLRSGVSHIRLIDFDMVTLSSLNRHAVATLADVGVPKVTACKQFFERVAPWVEVDARVELWKLEAGGKDLLEWGGSQVDWVIGPTTKLLYSLRWVLEQSVIPREYKLGYLLTFHPFMITPVDFSLSDISNTFEDPLARSVRRRLRLEGVESGIPVVYSTEKPGDVKLLPLPQDEFEKGNVNELGAFDDFRVRILPVLGPLPALFGLHIATYVVCDIAGKPIPNPLAVKNRGKLYEKLGRDLLNRENRLTGGNVSKLPISEQDVAYIFEDLHRGRSTIPPHPVLARPQLSRWNVQEPLTTYNCVVLSQQEAQVLQDNGGVGDEIVKKGIWPAETSLVVRRRQQEATRVSQWEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.15
4 0.1
5 0.09
6 0.08
7 0.08
8 0.07
9 0.06
10 0.05
11 0.05
12 0.04
13 0.05
14 0.05
15 0.06
16 0.08
17 0.09
18 0.15
19 0.21
20 0.3
21 0.37
22 0.45
23 0.55
24 0.62
25 0.72
26 0.77
27 0.82
28 0.85
29 0.89
30 0.92
31 0.88
32 0.85
33 0.8
34 0.7
35 0.65
36 0.55
37 0.47
38 0.41
39 0.35
40 0.29
41 0.25
42 0.25
43 0.19
44 0.18
45 0.18
46 0.19
47 0.23
48 0.25
49 0.24
50 0.23
51 0.24
52 0.24
53 0.3
54 0.24
55 0.2
56 0.19
57 0.21
58 0.22
59 0.21
60 0.24
61 0.15
62 0.16
63 0.16
64 0.15
65 0.18
66 0.19
67 0.22
68 0.2
69 0.21
70 0.2
71 0.2
72 0.24
73 0.22
74 0.23
75 0.21
76 0.2
77 0.19
78 0.2
79 0.22
80 0.23
81 0.2
82 0.16
83 0.15
84 0.16
85 0.15
86 0.13
87 0.13
88 0.09
89 0.1
90 0.09
91 0.1
92 0.1
93 0.1
94 0.11
95 0.1
96 0.11
97 0.1
98 0.1
99 0.11
100 0.12
101 0.12
102 0.11
103 0.1
104 0.08
105 0.08
106 0.07
107 0.04
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.03
114 0.03
115 0.04
116 0.04
117 0.04
118 0.04
119 0.06
120 0.07
121 0.09
122 0.1
123 0.1
124 0.11
125 0.11
126 0.13
127 0.15
128 0.13
129 0.12
130 0.11
131 0.1
132 0.09
133 0.1
134 0.08
135 0.06
136 0.08
137 0.08
138 0.08
139 0.08
140 0.08
141 0.09
142 0.09
143 0.09
144 0.09
145 0.08
146 0.08
147 0.08
148 0.08
149 0.07
150 0.07
151 0.05
152 0.07
153 0.1
154 0.16
155 0.17
156 0.21
157 0.24
158 0.29
159 0.3
160 0.32
161 0.31
162 0.28
163 0.29
164 0.26
165 0.23
166 0.2
167 0.19
168 0.15
169 0.14
170 0.11
171 0.09
172 0.08
173 0.08
174 0.07
175 0.07
176 0.07
177 0.07
178 0.08
179 0.08
180 0.1
181 0.11
182 0.11
183 0.11
184 0.11
185 0.1
186 0.08
187 0.07
188 0.06
189 0.05
190 0.05
191 0.05
192 0.04
193 0.04
194 0.04
195 0.04
196 0.05
197 0.04
198 0.05
199 0.05
200 0.06
201 0.06
202 0.07
203 0.08
204 0.07
205 0.1
206 0.13
207 0.14
208 0.14
209 0.14
210 0.14
211 0.15
212 0.16
213 0.15
214 0.16
215 0.16
216 0.16
217 0.16
218 0.16
219 0.14
220 0.13
221 0.13
222 0.09
223 0.08
224 0.1
225 0.12
226 0.14
227 0.14
228 0.13
229 0.12
230 0.11
231 0.11
232 0.12
233 0.1
234 0.08
235 0.08
236 0.09
237 0.09
238 0.09
239 0.11
240 0.08
241 0.09
242 0.08
243 0.09
244 0.08
245 0.08
246 0.08
247 0.07
248 0.07
249 0.08
250 0.11
251 0.13
252 0.14
253 0.15
254 0.23
255 0.3
256 0.37
257 0.39
258 0.4
259 0.43
260 0.46
261 0.48
262 0.43
263 0.38
264 0.31
265 0.28
266 0.24
267 0.17
268 0.13
269 0.09
270 0.06
271 0.06
272 0.06
273 0.08
274 0.09
275 0.1
276 0.1
277 0.11
278 0.13
279 0.12
280 0.13
281 0.15
282 0.18
283 0.18
284 0.19
285 0.19
286 0.17
287 0.2
288 0.19
289 0.17
290 0.15
291 0.2
292 0.19
293 0.21
294 0.2
295 0.17
296 0.16
297 0.15
298 0.16
299 0.11
300 0.11
301 0.08
302 0.1
303 0.1
304 0.1
305 0.11
306 0.09
307 0.09
308 0.1
309 0.1
310 0.09
311 0.1
312 0.1
313 0.09
314 0.09
315 0.09
316 0.08
317 0.07
318 0.06
319 0.05
320 0.06
321 0.05
322 0.05
323 0.04
324 0.04
325 0.05
326 0.05
327 0.04
328 0.04
329 0.04
330 0.05
331 0.09
332 0.12
333 0.12
334 0.12
335 0.17
336 0.18
337 0.19
338 0.21
339 0.22
340 0.3
341 0.36
342 0.41
343 0.41
344 0.45
345 0.48
346 0.5
347 0.47
348 0.46
349 0.48
350 0.44
351 0.44
352 0.43
353 0.41
354 0.39
355 0.41
356 0.42
357 0.43
358 0.43
359 0.4
360 0.38
361 0.36
362 0.35
363 0.32
364 0.27
365 0.22
366 0.23
367 0.23
368 0.23
369 0.23
370 0.21
371 0.21
372 0.2
373 0.21
374 0.21
375 0.21
376 0.22
377 0.22
378 0.23
379 0.23
380 0.2
381 0.14
382 0.11
383 0.15
384 0.13
385 0.16
386 0.16
387 0.16
388 0.17
389 0.24
390 0.28
391 0.32
392 0.39
393 0.37
394 0.38
395 0.41
396 0.43
397 0.43
398 0.46
399 0.44
400 0.4
401 0.41
402 0.48
403 0.48
404 0.51
405 0.49
406 0.48
407 0.45
408 0.44
409 0.45
410 0.39
411 0.42
412 0.39
413 0.36
414 0.29
415 0.29
416 0.28
417 0.23
418 0.21
419 0.16
420 0.18
421 0.19
422 0.21
423 0.2
424 0.2
425 0.21
426 0.26
427 0.24
428 0.2
429 0.18
430 0.16
431 0.14
432 0.14
433 0.13
434 0.07
435 0.12
436 0.14
437 0.13
438 0.13
439 0.13
440 0.13
441 0.17
442 0.21
443 0.17
444 0.17
445 0.2
446 0.25
447 0.27
448 0.29
449 0.34
450 0.37
451 0.4
452 0.45
453 0.47
454 0.47
455 0.53
456 0.57
457 0.58
458 0.59
459 0.63
460 0.64