Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5QRN1

Protein Details
Accession A0A5N5QRN1    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-43MVKIVKKRTKVFKRHQSDRYVSVKEAWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
7-14KRTKVFKR
24-51KEAWRKPKGIDNRVRRRFKGQLPMPKIG
56-57KK
Subcellular Location(s) nucl 14.5, mito_nucl 13, mito 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVKIVKKRTKVFKRHQSDRYVSVKEAWRKPKGIDNRVRRRFKGQLPMPKIGYGSNKKTRHHLPNGLKKLVVNNVRELELLLMHNKSFAAEIAHGVSSKNRVTILERARALSIKVTNPAAKLRSEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.88
3 0.86
4 0.8
5 0.77
6 0.74
7 0.66
8 0.57
9 0.53
10 0.54
11 0.53
12 0.56
13 0.57
14 0.55
15 0.54
16 0.55
17 0.58
18 0.6
19 0.61
20 0.63
21 0.65
22 0.71
23 0.79
24 0.83
25 0.77
26 0.74
27 0.71
28 0.68
29 0.68
30 0.65
31 0.65
32 0.64
33 0.66
34 0.6
35 0.53
36 0.46
37 0.38
38 0.38
39 0.33
40 0.35
41 0.41
42 0.45
43 0.45
44 0.5
45 0.55
46 0.56
47 0.56
48 0.58
49 0.58
50 0.63
51 0.68
52 0.63
53 0.56
54 0.47
55 0.43
56 0.41
57 0.37
58 0.28
59 0.25
60 0.26
61 0.26
62 0.26
63 0.23
64 0.17
65 0.12
66 0.12
67 0.1
68 0.09
69 0.08
70 0.09
71 0.09
72 0.08
73 0.08
74 0.07
75 0.08
76 0.07
77 0.09
78 0.1
79 0.11
80 0.11
81 0.11
82 0.12
83 0.14
84 0.14
85 0.14
86 0.14
87 0.15
88 0.19
89 0.27
90 0.32
91 0.35
92 0.36
93 0.36
94 0.37
95 0.37
96 0.34
97 0.31
98 0.29
99 0.24
100 0.28
101 0.3
102 0.31
103 0.32
104 0.37
105 0.34