Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A5N5Q654

Protein Details
Accession A0A5N5Q654    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
29-48ARTIPTKPSHPKKSNLSRDLHydrophilic
NLS Segment(s)
PositionSequence
66-95KKLIAKKRKAVDAPAPVSNKKARKTANPTK
126-140KKAKAQGPAKAKSKP
Subcellular Location(s) nucl 23.5, cyto_nucl 12.5
Family & Domain DBs
Amino Acid Sequences MRTNVQSQAKKVSRQVESEDDNEEMSAPARTIPTKPSHPKKSNLSRDLPARSPSPIQPLPPIVDTKKLIAKKRKAVDAPAPVSNKKARKTANPTKPASKSSAAVPPIPETQITAADPADKVLEPVKKAKAQGPAKAKSKPQTKSGLKVSTSLLSVVYN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.55
3 0.52
4 0.5
5 0.47
6 0.43
7 0.35
8 0.31
9 0.27
10 0.22
11 0.15
12 0.12
13 0.1
14 0.07
15 0.08
16 0.1
17 0.11
18 0.12
19 0.17
20 0.23
21 0.32
22 0.42
23 0.51
24 0.6
25 0.64
26 0.7
27 0.75
28 0.8
29 0.81
30 0.77
31 0.72
32 0.67
33 0.67
34 0.65
35 0.58
36 0.5
37 0.41
38 0.36
39 0.34
40 0.31
41 0.32
42 0.28
43 0.27
44 0.27
45 0.27
46 0.27
47 0.25
48 0.27
49 0.2
50 0.22
51 0.22
52 0.21
53 0.25
54 0.29
55 0.35
56 0.41
57 0.47
58 0.5
59 0.54
60 0.58
61 0.53
62 0.53
63 0.52
64 0.5
65 0.46
66 0.43
67 0.41
68 0.35
69 0.36
70 0.37
71 0.35
72 0.31
73 0.34
74 0.32
75 0.39
76 0.49
77 0.56
78 0.61
79 0.64
80 0.64
81 0.65
82 0.66
83 0.59
84 0.54
85 0.45
86 0.36
87 0.32
88 0.34
89 0.29
90 0.27
91 0.26
92 0.24
93 0.23
94 0.23
95 0.19
96 0.14
97 0.14
98 0.14
99 0.13
100 0.11
101 0.1
102 0.11
103 0.11
104 0.1
105 0.11
106 0.09
107 0.09
108 0.13
109 0.17
110 0.18
111 0.23
112 0.28
113 0.3
114 0.33
115 0.37
116 0.42
117 0.45
118 0.51
119 0.54
120 0.57
121 0.59
122 0.63
123 0.65
124 0.64
125 0.67
126 0.63
127 0.61
128 0.64
129 0.64
130 0.67
131 0.69
132 0.68
133 0.6
134 0.58
135 0.54
136 0.46
137 0.41
138 0.33